BLASTX nr result
ID: Ophiopogon22_contig00023520
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00023520 (560 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB54410.1| hypothetical protein B456_009G032900 [Gossypium r... 51 5e-13 gb|PPD89040.1| hypothetical protein GOBAR_DD14041 [Gossypium bar... 51 5e-13 gb|PPR92226.1| hypothetical protein GOBAR_AA28448 [Gossypium bar... 51 6e-13 gb|AFG19393.1| lycopene epsilon cyclase [Narcissus tazetta var. ... 56 7e-06 gb|OAY71859.1| Lycopene epsilon cyclase, chloroplastic, partial ... 56 7e-06 ref|XP_020105737.1| lycopene epsilon cyclase, chloroplastic [Ana... 56 7e-06 >gb|KJB54410.1| hypothetical protein B456_009G032900 [Gossypium raimondii] Length = 540 Score = 51.2 bits (121), Expect(2) = 5e-13 Identities = 36/85 (42%), Positives = 42/85 (49%), Gaps = 1/85 (1%) Frame = -3 Query: 255 PIFLYEMPMLSI*VFFEVNSYSG*MILTYVLFLAILYSMTI*LQ*TCLASKDAMPFD-XX 79 P FLY MPM S VFFE + LQ TCLASKDAMPFD Sbjct: 309 PTFLYAMPMSSTRVFFE----------------------KVALQETCLASKDAMPFDLLK 346 Query: 78 XXXXXXLDAMGVRALKVYEKSRQWI 4 L++MG+R LKVYE+ +I Sbjct: 347 KKLMSRLESMGIRILKVYEEEWSYI 371 Score = 50.4 bits (119), Expect(2) = 5e-13 Identities = 21/40 (52%), Positives = 28/40 (70%) Frame = -1 Query: 350 QVENNPYDPLLMIFMDYRDFAKEKEHYPKEEIPYFFMRCP 231 +VENNPYDP LM+FMDYRD+AK++ + + P F P Sbjct: 277 EVENNPYDPSLMVFMDYRDYAKQEVQSLEAQYPTFLYAMP 316 >gb|PPD89040.1| hypothetical protein GOBAR_DD14041 [Gossypium barbadense] Length = 530 Score = 51.2 bits (121), Expect(2) = 5e-13 Identities = 36/85 (42%), Positives = 42/85 (49%), Gaps = 1/85 (1%) Frame = -3 Query: 255 PIFLYEMPMLSI*VFFEVNSYSG*MILTYVLFLAILYSMTI*LQ*TCLASKDAMPFD-XX 79 P FLY MPM S VFFE + LQ TCLASKDAMPFD Sbjct: 299 PTFLYAMPMSSTRVFFE----------------------KVALQETCLASKDAMPFDLLK 336 Query: 78 XXXXXXLDAMGVRALKVYEKSRQWI 4 L++MG+R LKVYE+ +I Sbjct: 337 KKLMSRLESMGIRILKVYEEEWSYI 361 Score = 50.4 bits (119), Expect(2) = 5e-13 Identities = 21/40 (52%), Positives = 28/40 (70%) Frame = -1 Query: 350 QVENNPYDPLLMIFMDYRDFAKEKEHYPKEEIPYFFMRCP 231 +VENNPYDP LM+FMDYRD+AK++ + + P F P Sbjct: 267 EVENNPYDPSLMVFMDYRDYAKQEVQSLEAQYPTFLYAMP 306 >gb|PPR92226.1| hypothetical protein GOBAR_AA28448 [Gossypium barbadense] Length = 546 Score = 50.8 bits (120), Expect(2) = 6e-13 Identities = 36/85 (42%), Positives = 41/85 (48%), Gaps = 1/85 (1%) Frame = -3 Query: 255 PIFLYEMPMLSI*VFFEVNSYSG*MILTYVLFLAILYSMTI*LQ*TCLASKDAMPFD-XX 79 P FLY MPM S VFFE + LQ TCLASKDAMPFD Sbjct: 299 PTFLYAMPMSSTRVFFE----------------------KVALQETCLASKDAMPFDLLK 336 Query: 78 XXXXXXLDAMGVRALKVYEKSRQWI 4 L+ MG+R LKVYE+ +I Sbjct: 337 KKLMSRLETMGIRILKVYEEEWSYI 361 Score = 50.4 bits (119), Expect(2) = 6e-13 Identities = 21/40 (52%), Positives = 28/40 (70%) Frame = -1 Query: 350 QVENNPYDPLLMIFMDYRDFAKEKEHYPKEEIPYFFMRCP 231 +VENNPYDP LM+FMDYRD+AK++ + + P F P Sbjct: 267 EVENNPYDPSLMVFMDYRDYAKQEVQSLEAQYPTFLYAMP 306 >gb|AFG19393.1| lycopene epsilon cyclase [Narcissus tazetta var. chinensis] Length = 532 Score = 56.2 bits (134), Expect = 7e-06 Identities = 26/56 (46%), Positives = 34/56 (60%) Frame = -1 Query: 350 QVENNPYDPLLMIFMDYRDFAKEKEHYPKEEIPYFFMRCPCYLYEYFLKLTLILAK 183 +VENNPYDP LM+FMDYRD+ KEK H +E P F P F + T + ++ Sbjct: 277 EVENNPYDPSLMVFMDYRDYMKEKMHCLDKEFPTFLYVMPMSPTRVFFEETCLASR 332 >gb|OAY71859.1| Lycopene epsilon cyclase, chloroplastic, partial [Ananas comosus] Length = 533 Score = 56.2 bits (134), Expect = 7e-06 Identities = 26/56 (46%), Positives = 34/56 (60%) Frame = -1 Query: 350 QVENNPYDPLLMIFMDYRDFAKEKEHYPKEEIPYFFMRCPCYLYEYFLKLTLILAK 183 +VENNPYDP LM+FMDYRDF K+K+ P+ E P F F + T + +K Sbjct: 276 EVENNPYDPSLMVFMDYRDFVKDKKPCPEAEYPTFLYAMSMSPTRVFFEETCLASK 331 >ref|XP_020105737.1| lycopene epsilon cyclase, chloroplastic [Ananas comosus] Length = 562 Score = 56.2 bits (134), Expect = 7e-06 Identities = 26/56 (46%), Positives = 34/56 (60%) Frame = -1 Query: 350 QVENNPYDPLLMIFMDYRDFAKEKEHYPKEEIPYFFMRCPCYLYEYFLKLTLILAK 183 +VENNPYDP LM+FMDYRDF K+K+ P+ E P F F + T + +K Sbjct: 304 EVENNPYDPSLMVFMDYRDFVKDKKPCPEAEYPTFLYAMSMSPTRVFFEETCLASK 359