BLASTX nr result
ID: Ophiopogon22_contig00023048
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00023048 (472 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020253142.1| uncharacterized protein LOC109830316 [Aspara... 57 2e-07 >ref|XP_020253142.1| uncharacterized protein LOC109830316 [Asparagus officinalis] Length = 105 Score = 56.6 bits (135), Expect = 2e-07 Identities = 31/50 (62%), Positives = 33/50 (66%) Frame = +2 Query: 2 ICGLXXXXXXXXXXXRHRLTRFYNSNASLGNSRSGKEENSEKLSSEISTA 151 I GL RHRL+RFYNSN SL +SR GKEENSEK SSEI TA Sbjct: 55 IFGLRKKAVKPKPLTRHRLSRFYNSNNSLRHSRLGKEENSEKSSSEIQTA 104