BLASTX nr result
ID: Ophiopogon22_contig00022052
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00022052 (975 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252251.1| uncharacterized protein LOC109829598 [Aspara... 59 3e-06 >ref|XP_020252251.1| uncharacterized protein LOC109829598 [Asparagus officinalis] Length = 343 Score = 59.3 bits (142), Expect = 3e-06 Identities = 35/87 (40%), Positives = 43/87 (49%) Frame = +3 Query: 96 RRFRLCFRCGDRSHLAMECRNMVRCRRCNKDGHVFKDCRIWQWEQGLFNFPNQRHGEGGR 275 RR RLCFRCG H+A +CR+ + C RC + GH ++CR G N G GG Sbjct: 121 RRNRLCFRCGGSKHMAKDCRDPIVCFRCQEVGHEARNCRSGVPGHG---SDNSGRGNGG- 176 Query: 276 LQNWRPRNFQGGGRNPNPNFSSRGRGN 356 R F+G GRN GRGN Sbjct: 177 ---GRGFGFEGIGRNFGGRVFPGGRGN 200