BLASTX nr result
ID: Ophiopogon22_contig00021199
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00021199 (515 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020247530.1| uncharacterized protein LOC109825174 isoform... 58 1e-06 ref|XP_020247529.1| uncharacterized protein LOC109825174 isoform... 58 1e-06 >ref|XP_020247530.1| uncharacterized protein LOC109825174 isoform X2 [Asparagus officinalis] Length = 523 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 424 FYIPSPHERHASPGSEGEVSLPGIEGFQII 513 FYIP+PHE SPGSEGEVSLPGIEGFQII Sbjct: 338 FYIPTPHEGQTSPGSEGEVSLPGIEGFQII 367 >ref|XP_020247529.1| uncharacterized protein LOC109825174 isoform X1 [Asparagus officinalis] gb|ONK56045.1| uncharacterized protein A4U43_C10F3570 [Asparagus officinalis] Length = 580 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 424 FYIPSPHERHASPGSEGEVSLPGIEGFQII 513 FYIP+PHE SPGSEGEVSLPGIEGFQII Sbjct: 338 FYIPTPHEGQTSPGSEGEVSLPGIEGFQII 367