BLASTX nr result
ID: Ophiopogon22_contig00021105
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00021105 (437 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020251812.1| protein AAR2 homolog [Asparagus officinalis]... 67 3e-10 >ref|XP_020251812.1| protein AAR2 homolog [Asparagus officinalis] gb|ONK81457.1| uncharacterized protein A4U43_C01F29290 [Asparagus officinalis] Length = 407 Score = 67.4 bits (163), Expect = 3e-10 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 393 ETTLGWEFKNSGVDAMHEDDDDEFAPVVVLPNDAIPSEDR 274 E LGWEF+ + VDAM +++DDEFAPVVVLPNDAIPSEDR Sbjct: 366 ERVLGWEFQFNAVDAMDDEEDDEFAPVVVLPNDAIPSEDR 405