BLASTX nr result
ID: Ophiopogon22_contig00020995
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00020995 (452 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020264612.1| serrate RNA effector molecule [Asparagus off... 72 1e-11 gb|ONK69550.1| uncharacterized protein A4U43_C05F24150 [Asparagu... 72 1e-11 ref|XP_018683818.1| PREDICTED: serrate RNA effector molecule-lik... 70 3e-11 ref|XP_009403043.1| PREDICTED: serrate RNA effector molecule-lik... 70 3e-11 ref|XP_009381593.1| PREDICTED: serrate RNA effector molecule [Mu... 70 4e-11 ref|XP_010929331.1| PREDICTED: serrate RNA effector molecule [El... 69 8e-11 ref|XP_010927259.1| PREDICTED: serrate RNA effector molecule iso... 69 8e-11 ref|XP_010927258.1| PREDICTED: serrate RNA effector molecule iso... 69 8e-11 ref|XP_009410216.1| PREDICTED: serrate RNA effector molecule iso... 68 3e-10 ref|XP_008799465.1| PREDICTED: serrate RNA effector molecule [Ph... 68 3e-10 ref|XP_015693694.1| PREDICTED: serrate RNA effector molecule-lik... 67 5e-10 ref|XP_020114858.1| serrate RNA effector molecule [Ananas comosu... 67 5e-10 ref|XP_011090242.1| serrate RNA effector molecule-like [Sesamum ... 66 1e-09 gb|PAN22557.1| hypothetical protein PAHAL_D00007 [Panicum hallii] 66 1e-09 ref|XP_020682721.1| serrate RNA effector molecule [Dendrobium ca... 66 1e-09 gb|KQL11785.1| hypothetical protein SETIT_005946mg [Setaria ital... 66 1e-09 ref|XP_004966125.2| serrate RNA effector molecule [Setaria italica] 66 1e-09 ref|XP_019440877.1| PREDICTED: serrate RNA effector molecule-lik... 65 2e-09 gb|OIW13288.1| hypothetical protein TanjilG_25767 [Lupinus angus... 65 2e-09 ref|XP_015876193.1| PREDICTED: serrate RNA effector molecule-lik... 65 2e-09 >ref|XP_020264612.1| serrate RNA effector molecule [Asparagus officinalis] Length = 658 Score = 71.6 bits (174), Expect = 1e-11 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = +2 Query: 2 PILTVPTAMRHDPRRIRSYHDLDAPDDEVTVIDYRSL 112 PIL +P AMRHDPRRIRSY DLDAPDDEVTVIDYRSL Sbjct: 622 PILAMPPAMRHDPRRIRSYQDLDAPDDEVTVIDYRSL 658 >gb|ONK69550.1| uncharacterized protein A4U43_C05F24150 [Asparagus officinalis] Length = 704 Score = 71.6 bits (174), Expect = 1e-11 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = +2 Query: 2 PILTVPTAMRHDPRRIRSYHDLDAPDDEVTVIDYRSL 112 PIL +P AMRHDPRRIRSY DLDAPDDEVTVIDYRSL Sbjct: 668 PILAMPPAMRHDPRRIRSYQDLDAPDDEVTVIDYRSL 704 >ref|XP_018683818.1| PREDICTED: serrate RNA effector molecule-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 570 Score = 70.5 bits (171), Expect = 3e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 2 PILTVPTAMRHDPRRIRSYHDLDAPDDEVTVIDYRSL 112 PIL +P+A RHDPRRIRSY DLDAPDDEVTV+DYRSL Sbjct: 534 PILPIPSAFRHDPRRIRSYQDLDAPDDEVTVVDYRSL 570 >ref|XP_009403043.1| PREDICTED: serrate RNA effector molecule-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 734 Score = 70.5 bits (171), Expect = 3e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 2 PILTVPTAMRHDPRRIRSYHDLDAPDDEVTVIDYRSL 112 PIL +P+A RHDPRRIRSY DLDAPDDEVTV+DYRSL Sbjct: 698 PILPIPSAFRHDPRRIRSYQDLDAPDDEVTVVDYRSL 734 >ref|XP_009381593.1| PREDICTED: serrate RNA effector molecule [Musa acuminata subsp. malaccensis] Length = 734 Score = 70.1 bits (170), Expect = 4e-11 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +2 Query: 2 PILTVPTAMRHDPRRIRSYHDLDAPDDEVTVIDYRSL 112 PIL++P A RHDPRRIRSY DLDAPDDEVTVIDYRSL Sbjct: 698 PILSMPPAFRHDPRRIRSYQDLDAPDDEVTVIDYRSL 734 >ref|XP_010929331.1| PREDICTED: serrate RNA effector molecule [Elaeis guineensis] Length = 740 Score = 69.3 bits (168), Expect = 8e-11 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +2 Query: 2 PILTVPTAMRHDPRRIRSYHDLDAPDDEVTVIDYRSL 112 PIL VP A RHDPRRIRSY DLDAP+DEVTVIDYRSL Sbjct: 704 PILAVPPAFRHDPRRIRSYQDLDAPEDEVTVIDYRSL 740 >ref|XP_010927259.1| PREDICTED: serrate RNA effector molecule isoform X2 [Elaeis guineensis] Length = 746 Score = 69.3 bits (168), Expect = 8e-11 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +2 Query: 2 PILTVPTAMRHDPRRIRSYHDLDAPDDEVTVIDYRSL 112 PIL VP A RHDPRRIRSY DLDAP+DEVTVIDYRSL Sbjct: 710 PILAVPPAFRHDPRRIRSYQDLDAPEDEVTVIDYRSL 746 >ref|XP_010927258.1| PREDICTED: serrate RNA effector molecule isoform X1 [Elaeis guineensis] Length = 751 Score = 69.3 bits (168), Expect = 8e-11 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +2 Query: 2 PILTVPTAMRHDPRRIRSYHDLDAPDDEVTVIDYRSL 112 PIL VP A RHDPRRIRSY DLDAP+DEVTVIDYRSL Sbjct: 715 PILAVPPAFRHDPRRIRSYQDLDAPEDEVTVIDYRSL 751 >ref|XP_009410216.1| PREDICTED: serrate RNA effector molecule isoform X1 [Musa acuminata subsp. malaccensis] Length = 724 Score = 67.8 bits (164), Expect = 3e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +2 Query: 2 PILTVPTAMRHDPRRIRSYHDLDAPDDEVTVIDYRSL 112 P+L +P A RHDPRRIRSY DLDAP+DEVTVIDYRSL Sbjct: 688 PVLAMPPAFRHDPRRIRSYQDLDAPEDEVTVIDYRSL 724 >ref|XP_008799465.1| PREDICTED: serrate RNA effector molecule [Phoenix dactylifera] ref|XP_008799466.1| PREDICTED: serrate RNA effector molecule [Phoenix dactylifera] Length = 747 Score = 67.8 bits (164), Expect = 3e-10 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 2 PILTVPTAMRHDPRRIRSYHDLDAPDDEVTVIDYRSL 112 PIL P A RHDPRRIRSY DLDAP+DEVTVIDYRSL Sbjct: 711 PILAAPPAFRHDPRRIRSYQDLDAPEDEVTVIDYRSL 747 >ref|XP_015693694.1| PREDICTED: serrate RNA effector molecule-like [Oryza brachyantha] Length = 647 Score = 67.0 bits (162), Expect = 5e-10 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = +2 Query: 2 PILTVPTAMRHDPRRIRSYHDLDAPDDEVTVIDYRSL 112 PI+T+P + RHDPRR+RSY+DLDAPD+EVTV+DYRSL Sbjct: 611 PIITMPPSFRHDPRRLRSYNDLDAPDEEVTVLDYRSL 647 >ref|XP_020114858.1| serrate RNA effector molecule [Ananas comosus] gb|OAY83351.1| Serrate RNA effector molecule [Ananas comosus] Length = 743 Score = 67.0 bits (162), Expect = 5e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +2 Query: 2 PILTVPTAMRHDPRRIRSYHDLDAPDDEVTVIDYRSL 112 P+L VP A +HDPRRIRSY DLDAP+DEVTVIDYRSL Sbjct: 707 PLLAVPPAFQHDPRRIRSYQDLDAPEDEVTVIDYRSL 743 >ref|XP_011090242.1| serrate RNA effector molecule-like [Sesamum indicum] Length = 752 Score = 66.2 bits (160), Expect = 1e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +2 Query: 2 PILTVPTAMRHDPRRIRSYHDLDAPDDEVTVIDYRSL 112 PI+ +P A+R DPRR+RSY+DLDAPDDEVTVIDYRSL Sbjct: 716 PIIALPPALRQDPRRLRSYNDLDAPDDEVTVIDYRSL 752 >gb|PAN22557.1| hypothetical protein PAHAL_D00007 [Panicum hallii] Length = 504 Score = 65.9 bits (159), Expect = 1e-09 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +2 Query: 2 PILTVPTAMRHDPRRIRSYHDLDAPDDEVTVIDYRSL 112 PI+T+P RHDPRR+RSY+DLDAPD+EVTV+DYRSL Sbjct: 468 PIITMPPNFRHDPRRLRSYNDLDAPDEEVTVLDYRSL 504 >ref|XP_020682721.1| serrate RNA effector molecule [Dendrobium catenatum] gb|PKU84631.1| Serrate RNA effector molecule [Dendrobium catenatum] Length = 703 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +2 Query: 2 PILTVPTAMRHDPRRIRSYHDLDAPDDEVTVIDYRSL 112 PIL +P A RHDPRR+RSY DLDAP+DEVTV+DYRSL Sbjct: 667 PILGIPPAFRHDPRRMRSYQDLDAPEDEVTVMDYRSL 703 >gb|KQL11785.1| hypothetical protein SETIT_005946mg [Setaria italica] Length = 716 Score = 65.9 bits (159), Expect = 1e-09 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +2 Query: 2 PILTVPTAMRHDPRRIRSYHDLDAPDDEVTVIDYRSL 112 PI+T+P RHDPRR+RSY+DLDAPD+EVTV+DYRSL Sbjct: 680 PIITMPPNFRHDPRRLRSYNDLDAPDEEVTVLDYRSL 716 >ref|XP_004966125.2| serrate RNA effector molecule [Setaria italica] Length = 776 Score = 65.9 bits (159), Expect = 1e-09 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +2 Query: 2 PILTVPTAMRHDPRRIRSYHDLDAPDDEVTVIDYRSL 112 PI+T+P RHDPRR+RSY+DLDAPD+EVTV+DYRSL Sbjct: 740 PIITMPPNFRHDPRRLRSYNDLDAPDEEVTVLDYRSL 776 >ref|XP_019440877.1| PREDICTED: serrate RNA effector molecule-like [Lupinus angustifolius] Length = 703 Score = 65.5 bits (158), Expect = 2e-09 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +2 Query: 2 PILTVPTAMRHDPRRIRSYHDLDAPDDEVTVIDYRSL 112 PI+ VP A R DPRR+RSY DLDAPDDEVTVIDYRSL Sbjct: 667 PIIAVPPAFRADPRRLRSYQDLDAPDDEVTVIDYRSL 703 >gb|OIW13288.1| hypothetical protein TanjilG_25767 [Lupinus angustifolius] Length = 715 Score = 65.5 bits (158), Expect = 2e-09 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +2 Query: 2 PILTVPTAMRHDPRRIRSYHDLDAPDDEVTVIDYRSL 112 PI+ VP A R DPRR+RSY DLDAPDDEVTVIDYRSL Sbjct: 679 PIIAVPPAFRADPRRLRSYQDLDAPDDEVTVIDYRSL 715 >ref|XP_015876193.1| PREDICTED: serrate RNA effector molecule-like [Ziziphus jujuba] Length = 737 Score = 65.1 bits (157), Expect = 2e-09 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +2 Query: 2 PILTVPTAMRHDPRRIRSYHDLDAPDDEVTVIDYRSL 112 PIL VP A R DPRR+RSY DLDAP+DEVTVIDYRSL Sbjct: 701 PILAVPPAFRQDPRRMRSYQDLDAPEDEVTVIDYRSL 737