BLASTX nr result
ID: Ophiopogon22_contig00020948
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00020948 (1654 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020693937.1| geranylgeranyl transferase type-2 subunit al... 57 6e-06 >ref|XP_020693937.1| geranylgeranyl transferase type-2 subunit alpha 1-like, partial [Dendrobium catenatum] Length = 158 Score = 57.0 bits (136), Expect = 6e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -1 Query: 1654 EELKFTMDMINTNFSNYSAWHNRR*INYAYFIFSG 1550 EELKFTMDMINTNFSNYSAWH+RR +++ + +SG Sbjct: 121 EELKFTMDMINTNFSNYSAWHSRRYLHHWHSHYSG 155