BLASTX nr result
ID: Ophiopogon22_contig00020863
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00020863 (474 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK72666.1| uncharacterized protein A4U43_C04F21820 [Asparagu... 118 6e-28 ref|XP_020261675.1| pentatricopeptide repeat-containing protein ... 118 9e-28 ref|XP_010943474.1| PREDICTED: pentatricopeptide repeat-containi... 105 2e-23 dbj|BAF10810.1| Os03g0136700 [Oryza sativa Japonica Group] 96 3e-23 dbj|BAS82187.1| Os03g0136700, partial [Oryza sativa Japonica Group] 96 5e-23 ref|XP_018676192.1| PREDICTED: pentatricopeptide repeat-containi... 102 2e-22 ref|XP_008785055.1| PREDICTED: pentatricopeptide repeat-containi... 102 2e-22 gb|OVA08879.1| Pentatricopeptide repeat [Macleaya cordata] 102 3e-22 ref|XP_010265494.1| PREDICTED: pentatricopeptide repeat-containi... 102 3e-22 ref|XP_020678630.1| pentatricopeptide repeat-containing protein ... 102 4e-22 ref|XP_020581733.1| pentatricopeptide repeat-containing protein ... 100 2e-21 ref|XP_021286406.1| pentatricopeptide repeat-containing protein ... 98 1e-20 ref|XP_006649360.1| PREDICTED: pentatricopeptide repeat-containi... 97 3e-20 ref|XP_020093264.1| pentatricopeptide repeat-containing protein ... 96 4e-20 gb|EAY88453.1| hypothetical protein OsI_09918 [Oryza sativa Indi... 96 4e-20 ref|XP_015630741.1| PREDICTED: pentatricopeptide repeat-containi... 96 4e-20 gb|OMP09714.1| hypothetical protein COLO4_05202 [Corchorus olito... 95 1e-19 ref|XP_007041747.2| PREDICTED: pentatricopeptide repeat-containi... 95 1e-19 gb|EOX97578.1| Tetratricopeptide repeat (TPR)-like superfamily p... 95 1e-19 ref|XP_012077735.1| pentatricopeptide repeat-containing protein ... 94 2e-19 >gb|ONK72666.1| uncharacterized protein A4U43_C04F21820 [Asparagus officinalis] Length = 574 Score = 118 bits (295), Expect = 6e-28 Identities = 53/58 (91%), Positives = 56/58 (96%) Frame = -3 Query: 472 ISSAVGTPVLVKKNVRICVSCHNAIKLISRFTEREIIVGDSRIYHHFTDGLCSCGDYW 299 ISS VG+PVLVKKNVRICVSCHNAIKLIS+FT+REIIVGDSRIYHHFTDG CSCGDYW Sbjct: 517 ISSTVGSPVLVKKNVRICVSCHNAIKLISKFTKREIIVGDSRIYHHFTDGFCSCGDYW 574 >ref|XP_020261675.1| pentatricopeptide repeat-containing protein At4g35130, chloroplastic [Asparagus officinalis] Length = 785 Score = 118 bits (295), Expect = 9e-28 Identities = 53/58 (91%), Positives = 56/58 (96%) Frame = -3 Query: 472 ISSAVGTPVLVKKNVRICVSCHNAIKLISRFTEREIIVGDSRIYHHFTDGLCSCGDYW 299 ISS VG+PVLVKKNVRICVSCHNAIKLIS+FT+REIIVGDSRIYHHFTDG CSCGDYW Sbjct: 728 ISSTVGSPVLVKKNVRICVSCHNAIKLISKFTKREIIVGDSRIYHHFTDGFCSCGDYW 785 >ref|XP_010943474.1| PREDICTED: pentatricopeptide repeat-containing protein At4g35130, chloroplastic [Elaeis guineensis] Length = 786 Score = 105 bits (262), Expect = 2e-23 Identities = 44/58 (75%), Positives = 53/58 (91%) Frame = -3 Query: 472 ISSAVGTPVLVKKNVRICVSCHNAIKLISRFTEREIIVGDSRIYHHFTDGLCSCGDYW 299 IS+ VG+P+LVKKNVRIC CH+AIKLISR+++REII+GD+RIYHHFTDG C CGDYW Sbjct: 729 ISTTVGSPILVKKNVRICNDCHHAIKLISRYSKREIIIGDTRIYHHFTDGFCCCGDYW 786 >dbj|BAF10810.1| Os03g0136700 [Oryza sativa Japonica Group] Length = 73 Score = 96.3 bits (238), Expect = 3e-23 Identities = 40/58 (68%), Positives = 50/58 (86%) Frame = -3 Query: 472 ISSAVGTPVLVKKNVRICVSCHNAIKLISRFTEREIIVGDSRIYHHFTDGLCSCGDYW 299 ISS +G+P+LVKKNVRIC CH+A+KLISR++ R I+VGDS+IYH F+DG C CGDYW Sbjct: 16 ISSEIGSPILVKKNVRICNHCHHALKLISRYSGRRIVVGDSKIYHEFSDGSCCCGDYW 73 >dbj|BAS82187.1| Os03g0136700, partial [Oryza sativa Japonica Group] Length = 97 Score = 96.3 bits (238), Expect = 5e-23 Identities = 40/58 (68%), Positives = 50/58 (86%) Frame = -3 Query: 472 ISSAVGTPVLVKKNVRICVSCHNAIKLISRFTEREIIVGDSRIYHHFTDGLCSCGDYW 299 ISS +G+P+LVKKNVRIC CH+A+KLISR++ R I+VGDS+IYH F+DG C CGDYW Sbjct: 40 ISSEIGSPILVKKNVRICNHCHHALKLISRYSGRRIVVGDSKIYHEFSDGSCCCGDYW 97 >ref|XP_018676192.1| PREDICTED: pentatricopeptide repeat-containing protein At4g35130, chloroplastic [Musa acuminata subsp. malaccensis] Length = 783 Score = 102 bits (255), Expect = 2e-22 Identities = 45/58 (77%), Positives = 52/58 (89%) Frame = -3 Query: 472 ISSAVGTPVLVKKNVRICVSCHNAIKLISRFTEREIIVGDSRIYHHFTDGLCSCGDYW 299 ISS VG+PVLVKKNVRIC CH+A+KLIS F+ REIIVGD++IYHHF+DG CSCGDYW Sbjct: 726 ISSTVGSPVLVKKNVRICNHCHHAVKLISGFSGREIIVGDTKIYHHFSDGTCSCGDYW 783 >ref|XP_008785055.1| PREDICTED: pentatricopeptide repeat-containing protein At4g35130, chloroplastic [Phoenix dactylifera] Length = 787 Score = 102 bits (255), Expect = 2e-22 Identities = 42/58 (72%), Positives = 53/58 (91%) Frame = -3 Query: 472 ISSAVGTPVLVKKNVRICVSCHNAIKLISRFTEREIIVGDSRIYHHFTDGLCSCGDYW 299 IS+ VG+P+LV+KNVRIC CH+AIKLISR+++R+II+GD+RIYHHFTDG C CGDYW Sbjct: 730 ISTTVGSPILVRKNVRICNDCHHAIKLISRYSKRKIIIGDTRIYHHFTDGFCCCGDYW 787 >gb|OVA08879.1| Pentatricopeptide repeat [Macleaya cordata] Length = 687 Score = 102 bits (254), Expect = 3e-22 Identities = 45/58 (77%), Positives = 50/58 (86%) Frame = -3 Query: 472 ISSAVGTPVLVKKNVRICVSCHNAIKLISRFTEREIIVGDSRIYHHFTDGLCSCGDYW 299 IS+ VGTP+LV+KNVRIC CH+AIK IS+ TEREIIVGDS IYHHF DG CSCGDYW Sbjct: 630 ISTTVGTPILVRKNVRICEECHSAIKKISKVTEREIIVGDSSIYHHFRDGRCSCGDYW 687 >ref|XP_010265494.1| PREDICTED: pentatricopeptide repeat-containing protein At4g35130, chloroplastic [Nelumbo nucifera] Length = 803 Score = 102 bits (254), Expect = 3e-22 Identities = 43/58 (74%), Positives = 49/58 (84%) Frame = -3 Query: 472 ISSAVGTPVLVKKNVRICVSCHNAIKLISRFTEREIIVGDSRIYHHFTDGLCSCGDYW 299 IS +GTP+LV+KNVRIC CHNA K+IS+ T REIIVGDS+IYHHF DG CSCGDYW Sbjct: 746 ISMTIGTPILVRKNVRICQDCHNAAKIISKVTNREIIVGDSKIYHHFKDGCCSCGDYW 803 >ref|XP_020678630.1| pentatricopeptide repeat-containing protein At4g35130, chloroplastic [Dendrobium catenatum] gb|PKU63430.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 793 Score = 102 bits (253), Expect = 4e-22 Identities = 45/58 (77%), Positives = 50/58 (86%) Frame = -3 Query: 472 ISSAVGTPVLVKKNVRICVSCHNAIKLISRFTEREIIVGDSRIYHHFTDGLCSCGDYW 299 ISSA+GTPVLVKKN+RIC CH+AIK IS FT REI+VGDS IYHHF +GLC CGDYW Sbjct: 736 ISSALGTPVLVKKNIRICNDCHSAIKKISSFTGREIVVGDSSIYHHFNNGLCCCGDYW 793 >ref|XP_020581733.1| pentatricopeptide repeat-containing protein At4g35130, chloroplastic [Phalaenopsis equestris] Length = 793 Score = 100 bits (248), Expect = 2e-21 Identities = 45/58 (77%), Positives = 49/58 (84%) Frame = -3 Query: 472 ISSAVGTPVLVKKNVRICVSCHNAIKLISRFTEREIIVGDSRIYHHFTDGLCSCGDYW 299 ISSAVGTPVLVKKN+RIC CH+AIK IS FT R IIVGDS IYHHF +G+C CGDYW Sbjct: 736 ISSAVGTPVLVKKNIRICNDCHSAIKKISSFTGRAIIVGDSSIYHHFNNGVCCCGDYW 793 >ref|XP_021286406.1| pentatricopeptide repeat-containing protein At4g35130, chloroplastic [Herrania umbratica] Length = 810 Score = 97.8 bits (242), Expect = 1e-20 Identities = 40/58 (68%), Positives = 48/58 (82%) Frame = -3 Query: 472 ISSAVGTPVLVKKNVRICVSCHNAIKLISRFTEREIIVGDSRIYHHFTDGLCSCGDYW 299 IS+ VG PVLV+KN+RIC CHN K IS+FT+REI+VGD ++YHHF DG CSCGDYW Sbjct: 753 ISTEVGRPVLVRKNIRICEDCHNVAKRISKFTKREIVVGDPKLYHHFQDGCCSCGDYW 810 >ref|XP_006649360.1| PREDICTED: pentatricopeptide repeat-containing protein At4g35130, chloroplastic [Oryza brachyantha] Length = 787 Score = 96.7 bits (239), Expect = 3e-20 Identities = 39/58 (67%), Positives = 50/58 (86%) Frame = -3 Query: 472 ISSAVGTPVLVKKNVRICVSCHNAIKLISRFTEREIIVGDSRIYHHFTDGLCSCGDYW 299 ISS +G+P+LVKKNVRIC CHNA+KLIS+++ R I+VGD++IYH F+DG C CGDYW Sbjct: 730 ISSEIGSPILVKKNVRICNHCHNALKLISKYSRRRIVVGDTKIYHEFSDGSCCCGDYW 787 >ref|XP_020093264.1| pentatricopeptide repeat-containing protein At4g35130, chloroplastic [Ananas comosus] Length = 777 Score = 96.3 bits (238), Expect = 4e-20 Identities = 40/58 (68%), Positives = 50/58 (86%) Frame = -3 Query: 472 ISSAVGTPVLVKKNVRICVSCHNAIKLISRFTEREIIVGDSRIYHHFTDGLCSCGDYW 299 IS+ +GTP+LVKKNVRIC CH+A+KLIS + REIIVGD+R+YHHF++G C CGDYW Sbjct: 720 ISTEIGTPILVKKNVRICNHCHHALKLISESSGREIIVGDTRVYHHFSEGSCCCGDYW 777 >gb|EAY88453.1| hypothetical protein OsI_09918 [Oryza sativa Indica Group] Length = 781 Score = 96.3 bits (238), Expect = 4e-20 Identities = 40/58 (68%), Positives = 50/58 (86%) Frame = -3 Query: 472 ISSAVGTPVLVKKNVRICVSCHNAIKLISRFTEREIIVGDSRIYHHFTDGLCSCGDYW 299 ISS +G+P+LVKKNVRIC CH+A+KLISR++ R I+VGDS+IYH F+DG C CGDYW Sbjct: 724 ISSEIGSPILVKKNVRICNHCHHALKLISRYSGRRIVVGDSKIYHEFSDGSCCCGDYW 781 >ref|XP_015630741.1| PREDICTED: pentatricopeptide repeat-containing protein At4g35130, chloroplastic-like [Oryza sativa Japonica Group] gb|ABF93859.1| pentatricopeptide, putative, expressed [Oryza sativa Japonica Group] gb|EAZ25501.1| hypothetical protein OsJ_09324 [Oryza sativa Japonica Group] Length = 781 Score = 96.3 bits (238), Expect = 4e-20 Identities = 40/58 (68%), Positives = 50/58 (86%) Frame = -3 Query: 472 ISSAVGTPVLVKKNVRICVSCHNAIKLISRFTEREIIVGDSRIYHHFTDGLCSCGDYW 299 ISS +G+P+LVKKNVRIC CH+A+KLISR++ R I+VGDS+IYH F+DG C CGDYW Sbjct: 724 ISSEIGSPILVKKNVRICNHCHHALKLISRYSGRRIVVGDSKIYHEFSDGSCCCGDYW 781 >gb|OMP09714.1| hypothetical protein COLO4_05202 [Corchorus olitorius] Length = 800 Score = 95.1 bits (235), Expect = 1e-19 Identities = 38/58 (65%), Positives = 48/58 (82%) Frame = -3 Query: 472 ISSAVGTPVLVKKNVRICVSCHNAIKLISRFTEREIIVGDSRIYHHFTDGLCSCGDYW 299 IS+ +G PVLV+KN+RIC CHN K IS+ T+REI+VGDS+++HHF DG CSCGDYW Sbjct: 743 ISTELGNPVLVRKNIRICEDCHNVAKKISKITKREIVVGDSKLFHHFRDGCCSCGDYW 800 >ref|XP_007041747.2| PREDICTED: pentatricopeptide repeat-containing protein At4g35130, chloroplastic [Theobroma cacao] Length = 810 Score = 94.7 bits (234), Expect = 1e-19 Identities = 40/58 (68%), Positives = 47/58 (81%) Frame = -3 Query: 472 ISSAVGTPVLVKKNVRICVSCHNAIKLISRFTEREIIVGDSRIYHHFTDGLCSCGDYW 299 IS+ VG PVLV+KN+RIC CHN K IS+FT+REI+VGDS+ YHHF DG CSC DYW Sbjct: 753 ISTEVGRPVLVRKNIRICEDCHNVAKKISKFTKREIVVGDSKQYHHFQDGCCSCRDYW 810 >gb|EOX97578.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] Length = 810 Score = 94.7 bits (234), Expect = 1e-19 Identities = 40/58 (68%), Positives = 47/58 (81%) Frame = -3 Query: 472 ISSAVGTPVLVKKNVRICVSCHNAIKLISRFTEREIIVGDSRIYHHFTDGLCSCGDYW 299 IS+ VG PVLV+KN+RIC CHN K IS+FT+REI+VGDS+ YHHF DG CSC DYW Sbjct: 753 ISTEVGRPVLVRKNIRICEDCHNVAKKISKFTKREIVVGDSKQYHHFQDGCCSCRDYW 810 >ref|XP_012077735.1| pentatricopeptide repeat-containing protein At4g35130, chloroplastic [Jatropha curcas] Length = 801 Score = 94.4 bits (233), Expect = 2e-19 Identities = 39/58 (67%), Positives = 48/58 (82%) Frame = -3 Query: 472 ISSAVGTPVLVKKNVRICVSCHNAIKLISRFTEREIIVGDSRIYHHFTDGLCSCGDYW 299 IS+A+G P++++KN RIC CH A K ISR T+REIIVGDS+I+HHF DG CSCGDYW Sbjct: 744 ISTAIGKPIIIRKNTRICKDCHIAAKKISRVTKREIIVGDSKIFHHFEDGRCSCGDYW 801