BLASTX nr result
ID: Ophiopogon22_contig00020730
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00020730 (492 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK71855.1| uncharacterized protein A4U43_C04F13080 [Asparagu... 67 1e-10 ref|XP_020273108.1| endoplasmic reticulum oxidoreductin-1-like [... 67 7e-10 ref|XP_020686747.1| endoplasmic reticulum oxidoreductin-1-like [... 67 9e-10 gb|ONK64411.1| uncharacterized protein A4U43_C07F25620 [Asparagu... 67 9e-10 ref|XP_019159165.1| PREDICTED: endoplasmic reticulum oxidoreduct... 66 2e-09 ref|XP_019159164.1| PREDICTED: endoplasmic reticulum oxidoreduct... 66 2e-09 ref|XP_019159163.1| PREDICTED: endoplasmic reticulum oxidoreduct... 66 2e-09 ref|XP_010275885.1| PREDICTED: endoplasmic reticulum oxidoreduct... 64 8e-09 emb|CDP06120.1| unnamed protein product [Coffea canephora] 64 1e-08 ref|XP_020587405.1| endoplasmic reticulum oxidoreductin-1 [Phala... 63 1e-08 gb|KNA06491.1| hypothetical protein SOVF_180620 isoform B [Spina... 63 2e-08 ref|XP_016447449.1| PREDICTED: endoplasmic reticulum oxidoreduct... 59 2e-08 ref|XP_008794025.1| PREDICTED: endoplasmic reticulum oxidoreduct... 62 3e-08 gb|KMS98074.1| hypothetical protein BVRB_4g095870 [Beta vulgaris... 62 4e-08 ref|XP_010694837.1| PREDICTED: endoplasmic reticulum oxidoreduct... 62 4e-08 ref|XP_018805857.1| PREDICTED: endoplasmic reticulum oxidoreduct... 58 5e-08 ref|XP_009418840.1| PREDICTED: endoplasmic reticulum oxidoreduct... 61 7e-08 ref|XP_011098139.1| endoplasmic reticulum oxidoreductin-1 [Sesam... 61 9e-08 ref|XP_015690057.1| PREDICTED: endoplasmic reticulum oxidoreduct... 60 1e-07 gb|PKA65544.1| Endoplasmic oxidoreductin-1 [Apostasia shenzhenica] 60 1e-07 >gb|ONK71855.1| uncharacterized protein A4U43_C04F13080 [Asparagus officinalis] Length = 165 Score = 66.6 bits (161), Expect = 1e-10 Identities = 35/55 (63%), Positives = 40/55 (72%) Frame = -2 Query: 491 NQPLQFQRNEVIALVNLLNRLSESIHFVRKMSPHIDKIMAGGGEGSSPASKTTSL 327 NQPLQ QRNEVIA +NLLNRLSES+ FVRKM+P DK M G+ PA + SL Sbjct: 113 NQPLQLQRNEVIAFLNLLNRLSESVDFVRKMAPQFDKFME--GQHYHPAGGSVSL 165 >ref|XP_020273108.1| endoplasmic reticulum oxidoreductin-1-like [Asparagus officinalis] Length = 342 Score = 66.6 bits (161), Expect = 7e-10 Identities = 35/55 (63%), Positives = 40/55 (72%) Frame = -2 Query: 491 NQPLQFQRNEVIALVNLLNRLSESIHFVRKMSPHIDKIMAGGGEGSSPASKTTSL 327 NQPLQ QRNEVIA +NLLNRLSES+ FVRKM+P DK M G+ PA + SL Sbjct: 290 NQPLQLQRNEVIAFLNLLNRLSESVDFVRKMAPQFDKFME--GQHYHPAGGSVSL 342 >ref|XP_020686747.1| endoplasmic reticulum oxidoreductin-1-like [Dendrobium catenatum] gb|PKU64309.1| Endoplasmic oxidoreductin-1 [Dendrobium catenatum] Length = 452 Score = 66.6 bits (161), Expect = 9e-10 Identities = 36/52 (69%), Positives = 40/52 (76%) Frame = -2 Query: 491 NQPLQFQRNEVIALVNLLNRLSESIHFVRKMSPHIDKIMAGGGEGSSPASKT 336 NQPLQ QRNEVIALVNLLNRLSES++FVR+M P + IM SSPA KT Sbjct: 401 NQPLQLQRNEVIALVNLLNRLSESVNFVREMGPSAENIME--RRPSSPARKT 450 >gb|ONK64411.1| uncharacterized protein A4U43_C07F25620 [Asparagus officinalis] Length = 489 Score = 66.6 bits (161), Expect = 9e-10 Identities = 35/55 (63%), Positives = 40/55 (72%) Frame = -2 Query: 491 NQPLQFQRNEVIALVNLLNRLSESIHFVRKMSPHIDKIMAGGGEGSSPASKTTSL 327 NQPLQ QRNEVIA +NLLNRLSES+ FVRKM+P DK M G+ PA + SL Sbjct: 437 NQPLQLQRNEVIAFLNLLNRLSESVDFVRKMAPQFDKFME--GQHYHPAGGSVSL 489 >ref|XP_019159165.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like isoform X3 [Ipomoea nil] ref|XP_019159166.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like isoform X4 [Ipomoea nil] Length = 464 Score = 65.9 bits (159), Expect = 2e-09 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -2 Query: 488 QPLQFQRNEVIALVNLLNRLSESIHFVRKMSPHIDKIMAG 369 QPLQ QRNEVIAL+NLLNRLSESI FVR+MSP I+K+M G Sbjct: 395 QPLQLQRNEVIALMNLLNRLSESISFVREMSPDIEKVMEG 434 >ref|XP_019159164.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like isoform X2 [Ipomoea nil] Length = 479 Score = 65.9 bits (159), Expect = 2e-09 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -2 Query: 488 QPLQFQRNEVIALVNLLNRLSESIHFVRKMSPHIDKIMAG 369 QPLQ QRNEVIAL+NLLNRLSESI FVR+MSP I+K+M G Sbjct: 395 QPLQLQRNEVIALMNLLNRLSESISFVREMSPDIEKVMEG 434 >ref|XP_019159163.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like isoform X1 [Ipomoea nil] Length = 490 Score = 65.9 bits (159), Expect = 2e-09 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -2 Query: 488 QPLQFQRNEVIALVNLLNRLSESIHFVRKMSPHIDKIMAG 369 QPLQ QRNEVIAL+NLLNRLSESI FVR+MSP I+K+M G Sbjct: 395 QPLQLQRNEVIALMNLLNRLSESISFVREMSPDIEKVMEG 434 >ref|XP_010275885.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Nelumbo nucifera] Length = 461 Score = 63.9 bits (154), Expect = 8e-09 Identities = 33/52 (63%), Positives = 36/52 (69%) Frame = -2 Query: 491 NQPLQFQRNEVIALVNLLNRLSESIHFVRKMSPHIDKIMAGGGEGSSPASKT 336 NQPLQ QRNEVIALVNLLNRLSES+ F +M P +KIM G S S T Sbjct: 399 NQPLQLQRNEVIALVNLLNRLSESVKFAHEMGPAAEKIMEGQVSAPSTPSST 450 >emb|CDP06120.1| unnamed protein product [Coffea canephora] Length = 473 Score = 63.5 bits (153), Expect = 1e-08 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -2 Query: 491 NQPLQFQRNEVIALVNLLNRLSESIHFVRKMSPHIDKIMAG 369 NQPLQ QRNEVIALVNLLNRLSESI FV+++SP I+K M G Sbjct: 403 NQPLQLQRNEVIALVNLLNRLSESIKFVQEVSPSIEKKMDG 443 >ref|XP_020587405.1| endoplasmic reticulum oxidoreductin-1 [Phalaenopsis equestris] ref|XP_020587406.1| endoplasmic reticulum oxidoreductin-1 [Phalaenopsis equestris] Length = 448 Score = 63.2 bits (152), Expect = 1e-08 Identities = 34/51 (66%), Positives = 38/51 (74%) Frame = -2 Query: 491 NQPLQFQRNEVIALVNLLNRLSESIHFVRKMSPHIDKIMAGGGEGSSPASK 339 NQPLQ QRNEVIALVNLLNRLSES++FV +M P + IM SSPA K Sbjct: 397 NQPLQLQRNEVIALVNLLNRLSESVNFVHQMGPAAENIME--RRSSSPARK 445 >gb|KNA06491.1| hypothetical protein SOVF_180620 isoform B [Spinacia oleracea] Length = 358 Score = 62.8 bits (151), Expect = 2e-08 Identities = 32/51 (62%), Positives = 40/51 (78%) Frame = -2 Query: 491 NQPLQFQRNEVIALVNLLNRLSESIHFVRKMSPHIDKIMAGGGEGSSPASK 339 NQPLQ QRNEVIAL+NLLNRLSES+ V +M+P +DKI+ G+ S P S+ Sbjct: 290 NQPLQLQRNEVIALLNLLNRLSESVKLVHEMAPSVDKIV---GQVSGPPSQ 337 >ref|XP_016447449.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Nicotiana tabacum] Length = 101 Score = 58.9 bits (141), Expect = 2e-08 Identities = 35/59 (59%), Positives = 41/59 (69%) Frame = -2 Query: 491 NQPLQFQRNEVIALVNLLNRLSESIHFVRKMSPHIDKIMAGGGEGSSPASKTTSL*PRL 315 +Q LQ QRNEVIALVNLLNRLSESI V++MSP +K + GG PA+K S RL Sbjct: 37 DQHLQLQRNEVIALVNLLNRLSESIKLVQEMSPTFEKTI--GGLSLQPAAKLISSWKRL 93 >ref|XP_008794025.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like isoform X1 [Phoenix dactylifera] Length = 454 Score = 62.4 bits (150), Expect = 3e-08 Identities = 34/54 (62%), Positives = 40/54 (74%) Frame = -2 Query: 491 NQPLQFQRNEVIALVNLLNRLSESIHFVRKMSPHIDKIMAGGGEGSSPASKTTS 330 NQ LQ QRNEVIALVNLLNRLSES+ V +M P I+KIM G+ S P K++S Sbjct: 403 NQHLQLQRNEVIALVNLLNRLSESVKLVHEMGPSIEKIME--GQFSPPTRKSSS 454 >gb|KMS98074.1| hypothetical protein BVRB_4g095870 [Beta vulgaris subsp. vulgaris] Length = 444 Score = 62.0 bits (149), Expect = 4e-08 Identities = 32/54 (59%), Positives = 40/54 (74%) Frame = -2 Query: 491 NQPLQFQRNEVIALVNLLNRLSESIHFVRKMSPHIDKIMAGGGEGSSPASKTTS 330 NQPLQ QRNEVIAL+NLLNRLSES+ V +M+P DKI+ G+ + P S+ S Sbjct: 376 NQPLQLQRNEVIALINLLNRLSESVKLVHEMAPSADKIV---GQVAGPPSQEVS 426 >ref|XP_010694837.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Beta vulgaris subsp. vulgaris] Length = 466 Score = 62.0 bits (149), Expect = 4e-08 Identities = 32/54 (59%), Positives = 40/54 (74%) Frame = -2 Query: 491 NQPLQFQRNEVIALVNLLNRLSESIHFVRKMSPHIDKIMAGGGEGSSPASKTTS 330 NQPLQ QRNEVIAL+NLLNRLSES+ V +M+P DKI+ G+ + P S+ S Sbjct: 398 NQPLQLQRNEVIALINLLNRLSESVKLVHEMAPSADKIV---GQVAGPPSQEVS 448 >ref|XP_018805857.1| PREDICTED: endoplasmic reticulum oxidoreductin-2-like [Juglans regia] Length = 103 Score = 58.2 bits (139), Expect = 5e-08 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -2 Query: 491 NQPLQFQRNEVIALVNLLNRLSESIHFVRKMSPHIDKIMAG 369 +Q LQ QRNEVIAL+NLLNRLSES+ VR+M P ++KIM G Sbjct: 38 DQTLQLQRNEVIALMNLLNRLSESVKCVREMGPSVEKIMEG 78 >ref|XP_009418840.1| PREDICTED: endoplasmic reticulum oxidoreductin-1 [Musa acuminata subsp. malaccensis] Length = 451 Score = 61.2 bits (147), Expect = 7e-08 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = -2 Query: 491 NQPLQFQRNEVIALVNLLNRLSESIHFVRKMSPHIDKIMAGGGEGSSPASKTT 333 NQ LQ QRNEVIAL+NLLNRLSES+ FV P+ ++I+ GG+ SSP SK + Sbjct: 400 NQQLQLQRNEVIALMNLLNRLSESVKFVHDKGPYAERIV--GGKISSPTSKNS 450 >ref|XP_011098139.1| endoplasmic reticulum oxidoreductin-1 [Sesamum indicum] Length = 472 Score = 60.8 bits (146), Expect = 9e-08 Identities = 33/53 (62%), Positives = 39/53 (73%) Frame = -2 Query: 491 NQPLQFQRNEVIALVNLLNRLSESIHFVRKMSPHIDKIMAGGGEGSSPASKTT 333 NQPLQ QRNEVIAL+NLLNRLSESI+ V ++ P IDK M E SP +T+ Sbjct: 403 NQPLQLQRNEVIALLNLLNRLSESINLVHEIGPSIDKSMEFTSE--SPVQETS 453 >ref|XP_015690057.1| PREDICTED: endoplasmic reticulum oxidoreductin-1, partial [Oryza brachyantha] Length = 429 Score = 60.5 bits (145), Expect = 1e-07 Identities = 32/55 (58%), Positives = 40/55 (72%) Frame = -2 Query: 491 NQPLQFQRNEVIALVNLLNRLSESIHFVRKMSPHIDKIMAGGGEGSSPASKTTSL 327 NQPLQ QRNEVIALVNLLNRLSES++FV + P I++++ + SSP K L Sbjct: 377 NQPLQLQRNEVIALVNLLNRLSESVNFVHEKGPSIEEVIK---QQSSPTVKPVFL 428 >gb|PKA65544.1| Endoplasmic oxidoreductin-1 [Apostasia shenzhenica] Length = 445 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -2 Query: 491 NQPLQFQRNEVIALVNLLNRLSESIHFVRKMSPHIDKIM 375 NQ LQ QRNEVIALVNLLNRLSES+ FVR++ P DKIM Sbjct: 400 NQSLQLQRNEVIALVNLLNRLSESVKFVREVGPSSDKIM 438