BLASTX nr result
ID: Ophiopogon22_contig00019858
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00019858 (643 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK78237.1| uncharacterized protein A4U43_C02F16080, partial ... 96 2e-19 >gb|ONK78237.1| uncharacterized protein A4U43_C02F16080, partial [Asparagus officinalis] Length = 468 Score = 96.3 bits (238), Expect = 2e-19 Identities = 49/62 (79%), Positives = 51/62 (82%) Frame = -3 Query: 641 VFECVGGKTKESGYDRRRRHKPNYSNLALGSLPDVRFAFSQVVLDTLCSPTLKDDSSEDL 462 VFECVG KTKESGY+ RRRHK NYSNLA GSLPDVRFA SQVVLDTL P K+ S EDL Sbjct: 406 VFECVGRKTKESGYEGRRRHKLNYSNLASGSLPDVRFALSQVVLDTLYPPKPKNVSCEDL 465 Query: 461 PE 456 PE Sbjct: 466 PE 467