BLASTX nr result
ID: Ophiopogon22_contig00019776
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00019776 (493 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020258262.1| uncharacterized protein LOC109834641 [Aspara... 55 7e-06 >ref|XP_020258262.1| uncharacterized protein LOC109834641 [Asparagus officinalis] Length = 267 Score = 55.1 bits (131), Expect = 7e-06 Identities = 27/38 (71%), Positives = 28/38 (73%) Frame = -1 Query: 139 MASACVNNVAVPPSSAYGCFSPRISFSRDFPGDNGSDP 26 MASACVNNV VPPS YG FSPR+SFSRDFP P Sbjct: 1 MASACVNNVTVPPS--YGVFSPRVSFSRDFPPTKVGSP 36