BLASTX nr result
ID: Ophiopogon22_contig00019642
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00019642 (526 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022746980.1| E3 ubiquitin-protein ligase RDUF2-like [Duri... 57 3e-06 >ref|XP_022746980.1| E3 ubiquitin-protein ligase RDUF2-like [Durio zibethinus] ref|XP_022746981.1| E3 ubiquitin-protein ligase RDUF2-like [Durio zibethinus] ref|XP_022746982.1| E3 ubiquitin-protein ligase RDUF2-like [Durio zibethinus] Length = 366 Score = 56.6 bits (135), Expect = 3e-06 Identities = 20/31 (64%), Positives = 25/31 (80%) Frame = -3 Query: 308 YWCYRCNNFVRVQADGGSISCTDCGGGFLEE 216 YWCYRCN F+RV++ S+ C DCGGGF+EE Sbjct: 8 YWCYRCNRFIRVRSHQDSVHCPDCGGGFIEE 38