BLASTX nr result
ID: Ophiopogon22_contig00019295
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00019295 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020259328.1| NEDD8 ultimate buster 1 [Asparagus officinal... 64 4e-09 ref|XP_009406655.1| PREDICTED: NEDD8 ultimate buster 1 [Musa acu... 64 5e-09 ref|XP_008801924.1| PREDICTED: NEDD8 ultimate buster 1 [Phoenix ... 63 1e-08 ref|XP_020083129.1| NEDD8 ultimate buster 1 [Ananas comosus] 62 2e-08 gb|OAY85886.1| NEDD8 ultimate buster 1, partial [Ananas comosus] 62 2e-08 ref|XP_009387613.1| PREDICTED: uncharacterized protein LOC103974... 59 2e-08 gb|PKA51493.1| hypothetical protein AXF42_Ash002858 [Apostasia s... 62 2e-08 ref|XP_010907620.1| PREDICTED: NEDD8 ultimate buster 1 [Elaeis g... 62 3e-08 gb|PIA28707.1| hypothetical protein AQUCO_06700018v1 [Aquilegia ... 61 4e-08 gb|KDO73413.1| hypothetical protein CISIN_1g014748mg [Citrus sin... 60 9e-08 gb|KDO73411.1| hypothetical protein CISIN_1g014748mg [Citrus sin... 60 1e-07 dbj|GAY37365.1| hypothetical protein CUMW_028450 [Citrus unshiu] 60 1e-07 dbj|GAY37366.1| hypothetical protein CUMW_028450 [Citrus unshiu] 60 1e-07 ref|XP_020589026.1| NEDD8 ultimate buster 1 isoform X2 [Phalaeno... 60 1e-07 ref|XP_020589025.1| NEDD8 ultimate buster 1 isoform X1 [Phalaeno... 60 1e-07 ref|XP_010244884.1| PREDICTED: NEDD8 ultimate buster 1 [Nelumbo ... 60 1e-07 gb|EEF35116.1| conserved hypothetical protein [Ricinus communis] 55 2e-07 ref|XP_006852823.1| NEDD8 ultimate buster 1 [Amborella trichopod... 59 2e-07 ref|XP_023873703.1| NEDD8 ultimate buster 1 [Quercus suber] >gi|... 59 3e-07 ref|XP_006453132.1| NEDD8 ultimate buster 1 [Citrus clementina] ... 59 4e-07 >ref|XP_020259328.1| NEDD8 ultimate buster 1 [Asparagus officinalis] ref|XP_020259329.1| NEDD8 ultimate buster 1 [Asparagus officinalis] Length = 398 Score = 63.9 bits (154), Expect = 4e-09 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -1 Query: 426 EMENELVKKLRGDPLADYDIEVTKEGEAIVEYLALLDS 313 EME+EL++ L+GD +ADYDIEVTKEGEAI EYL+LLDS Sbjct: 350 EMEDELIRNLKGDAIADYDIEVTKEGEAIAEYLSLLDS 387 >ref|XP_009406655.1| PREDICTED: NEDD8 ultimate buster 1 [Musa acuminata subsp. malaccensis] Length = 568 Score = 63.9 bits (154), Expect = 5e-09 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -1 Query: 423 MENELVKKLRGDPLADYDIEVTKEGEAIVEYLALLDSQSN 304 ME+EL K+L GDPLADYD+EV KEGEAI EYLALLDS+++ Sbjct: 527 MEDELAKELTGDPLADYDMEVMKEGEAIAEYLALLDSKAS 566 >ref|XP_008801924.1| PREDICTED: NEDD8 ultimate buster 1 [Phoenix dactylifera] Length = 454 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -1 Query: 423 MENELVKKLRGDPLADYDIEVTKEGEAIVEYLALLDSQSN 304 ME E+ K+L GDPLADYDIEV KEGEA+ EY ALLDS +N Sbjct: 407 MEGEIAKELTGDPLADYDIEVAKEGEALEEYFALLDSNAN 446 >ref|XP_020083129.1| NEDD8 ultimate buster 1 [Ananas comosus] Length = 559 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -1 Query: 429 VEMENELVKKLRGDPLADYDIEVTKEGEAIVEYLALLDSQSN 304 VEME+EL KL GDP ADYDIEV +EGEAI EY++LL+S S+ Sbjct: 516 VEMEDELADKLTGDPFADYDIEVAREGEAIAEYMSLLESTSS 557 >gb|OAY85886.1| NEDD8 ultimate buster 1, partial [Ananas comosus] Length = 561 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -1 Query: 429 VEMENELVKKLRGDPLADYDIEVTKEGEAIVEYLALLDSQSN 304 VEME+EL KL GDP ADYDIEV +EGEAI EY++LL+S S+ Sbjct: 518 VEMEDELADKLTGDPFADYDIEVAREGEAIAEYMSLLESTSS 559 >ref|XP_009387613.1| PREDICTED: uncharacterized protein LOC103974487, partial [Musa acuminata subsp. malaccensis] Length = 128 Score = 59.3 bits (142), Expect = 2e-08 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -1 Query: 423 MENELVKKLRGDPLADYDIEVTKEGEAIVEYLALLDSQSN 304 +E+EL K+L GDPLADYD EV KEGEA +YLALLDS++N Sbjct: 87 VEDELAKELTGDPLADYDAEVMKEGEAKAKYLALLDSKAN 126 >gb|PKA51493.1| hypothetical protein AXF42_Ash002858 [Apostasia shenzhenica] Length = 475 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -1 Query: 426 EMENELVKKLRGDPLADYDIEVTKEGEAIVEYLALLDS 313 EME+EL K+LRGD ADYD+EV+KEGEAI EYLALL+S Sbjct: 404 EMEDELAKELRGDAFADYDLEVSKEGEAIAEYLALLES 441 >ref|XP_010907620.1| PREDICTED: NEDD8 ultimate buster 1 [Elaeis guineensis] Length = 537 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -1 Query: 423 MENELVKKLRGDPLADYDIEVTKEGEAIVEYLALLDSQSN 304 ME E+ K+L GDPLADYDIEV KEGEA+ EY ALLDS ++ Sbjct: 497 MEGEIAKELTGDPLADYDIEVAKEGEALAEYFALLDSNAS 536 >gb|PIA28707.1| hypothetical protein AQUCO_06700018v1 [Aquilegia coerulea] Length = 530 Score = 61.2 bits (147), Expect = 4e-08 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = -1 Query: 429 VEMENELVKKLRGDPLADYDIEVTKEGEAIVEYLALLDSQSNY 301 ++ME ++ ++L+GD L+DYDIEVT EGEAI EYLALL S NY Sbjct: 488 IDMEKQIARELKGDALSDYDIEVTTEGEAITEYLALLTSTGNY 530 >gb|KDO73413.1| hypothetical protein CISIN_1g014748mg [Citrus sinensis] Length = 365 Score = 60.1 bits (144), Expect = 9e-08 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = -1 Query: 429 VEMENELVKKLRGDPLADYDIEVTKEGEAIVEYLALLDS 313 VEME+EL L GD ADYDIEVTKEGEAI EYL+LLDS Sbjct: 316 VEMEDELANDLTGDVFADYDIEVTKEGEAISEYLSLLDS 354 >gb|KDO73411.1| hypothetical protein CISIN_1g014748mg [Citrus sinensis] Length = 419 Score = 60.1 bits (144), Expect = 1e-07 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = -1 Query: 429 VEMENELVKKLRGDPLADYDIEVTKEGEAIVEYLALLDS 313 VEME+EL L GD ADYDIEVTKEGEAI EYL+LLDS Sbjct: 370 VEMEDELANDLTGDVFADYDIEVTKEGEAISEYLSLLDS 408 >dbj|GAY37365.1| hypothetical protein CUMW_028450 [Citrus unshiu] Length = 464 Score = 60.1 bits (144), Expect = 1e-07 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = -1 Query: 429 VEMENELVKKLRGDPLADYDIEVTKEGEAIVEYLALLDS 313 VEME+EL L GD ADYDIEVTKEGEAI EYL+LLDS Sbjct: 415 VEMEDELANDLTGDVFADYDIEVTKEGEAISEYLSLLDS 453 >dbj|GAY37366.1| hypothetical protein CUMW_028450 [Citrus unshiu] Length = 506 Score = 60.1 bits (144), Expect = 1e-07 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = -1 Query: 429 VEMENELVKKLRGDPLADYDIEVTKEGEAIVEYLALLDS 313 VEME+EL L GD ADYDIEVTKEGEAI EYL+LLDS Sbjct: 457 VEMEDELANDLTGDVFADYDIEVTKEGEAISEYLSLLDS 495 >ref|XP_020589026.1| NEDD8 ultimate buster 1 isoform X2 [Phalaenopsis equestris] Length = 521 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 426 EMENELVKKLRGDPLADYDIEVTKEGEAIVEYLALLDSQSN 304 EME+EL K+L GD ADYD+EV+KEGEAI EYLALL+S ++ Sbjct: 475 EMEDELAKELTGDAYADYDLEVSKEGEAIAEYLALLESSTS 515 >ref|XP_020589025.1| NEDD8 ultimate buster 1 isoform X1 [Phalaenopsis equestris] Length = 522 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 426 EMENELVKKLRGDPLADYDIEVTKEGEAIVEYLALLDSQSN 304 EME+EL K+L GD ADYD+EV+KEGEAI EYLALL+S ++ Sbjct: 476 EMEDELAKELTGDAYADYDLEVSKEGEAIAEYLALLESSTS 516 >ref|XP_010244884.1| PREDICTED: NEDD8 ultimate buster 1 [Nelumbo nucifera] Length = 564 Score = 60.1 bits (144), Expect = 1e-07 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = -1 Query: 429 VEMENELVKKLRGDPLADYDIEVTKEGEAIVEYLALLDSQSNYQMD 292 +EME+ +V+++ GD L+DYDIEVTKEGEAI EYLALL S N D Sbjct: 516 MEMEDAIVQEITGDSLSDYDIEVTKEGEAIAEYLALLTSTGNSGKD 561 >gb|EEF35116.1| conserved hypothetical protein [Ricinus communis] Length = 80 Score = 55.5 bits (132), Expect = 2e-07 Identities = 27/40 (67%), Positives = 35/40 (87%), Gaps = 1/40 (2%) Frame = -1 Query: 429 VEMENELVKKL-RGDPLADYDIEVTKEGEAIVEYLALLDS 313 VEME+E+ +++ + D L+DYDI+VTKEGEAI EYLALLDS Sbjct: 30 VEMEDEIAEQIAKADALSDYDIDVTKEGEAITEYLALLDS 69 >ref|XP_006852823.1| NEDD8 ultimate buster 1 [Amborella trichopoda] ref|XP_020528206.1| NEDD8 ultimate buster 1 [Amborella trichopoda] gb|ERN14290.1| hypothetical protein AMTR_s00033p00177630 [Amborella trichopoda] Length = 554 Score = 59.3 bits (142), Expect = 2e-07 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -1 Query: 426 EMENELVKKLRGDPLADYDIEVTKEGEAIVEYLALLDS 313 EME ELV++L DP ADYDI+VTKEGEA+ EY+ALL+S Sbjct: 508 EMEEELVQELTSDPFADYDIDVTKEGEAVAEYVALLNS 545 >ref|XP_023873703.1| NEDD8 ultimate buster 1 [Quercus suber] gb|POE84264.1| nedd8 ultimate buster 1 [Quercus suber] Length = 556 Score = 58.9 bits (141), Expect = 3e-07 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = -1 Query: 429 VEMENELVKKL-RGDPLADYDIEVTKEGEAIVEYLALLDSQSNYQMDLLC 283 VEME+EL +L +GD L DYDIEVTKEGEAI EYLA+L+S N + C Sbjct: 507 VEMEDELADELAKGDALTDYDIEVTKEGEAISEYLAILESAGNSEKAPCC 556 >ref|XP_006453132.1| NEDD8 ultimate buster 1 [Citrus clementina] ref|XP_006474370.1| PREDICTED: NEDD8 ultimate buster 1 [Citrus sinensis] gb|ESR66372.1| hypothetical protein CICLE_v10007887mg [Citrus clementina] Length = 561 Score = 58.5 bits (140), Expect = 4e-07 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -1 Query: 429 VEMENELVKKLRGDPLADYDIEVTKEGEAIVEYLALLDS 313 VEME+EL L GD ADYDIEVTKEGEAI EYL+LL+S Sbjct: 512 VEMEDELANDLTGDVFADYDIEVTKEGEAISEYLSLLES 550