BLASTX nr result
ID: Ophiopogon22_contig00017997
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00017997 (348 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT08645.1| GAI-like protein, partial [Hyacinthus orientalis] 98 5e-23 ref|XP_009380281.1| PREDICTED: DELLA protein SLN1-like [Musa acu... 100 5e-22 ref|XP_020584529.1| DELLA protein SLR1-like [Phalaenopsis equest... 99 1e-21 ref|XP_009390245.1| PREDICTED: DELLA protein SLR1-like [Musa acu... 99 1e-21 ref|XP_020682060.1| DELLA protein SLN1-like [Dendrobium catenatu... 99 1e-21 ref|XP_010926472.1| PREDICTED: DELLA protein SLR1-like [Elaeis g... 99 1e-21 gb|EMS65108.1| hypothetical protein TRIUR3_18790 [Triticum urartu] 97 2e-21 gb|ADP02183.1| Rht-D1b [Triticum aestivum] 98 3e-21 ref|XP_020147810.1| DELLA protein RHT-1 [Aegilops tauschii subsp... 98 3e-21 sp|Q9ST59.1|RHT1_WHEAT RecName: Full=DELLA protein RHT-1; AltNam... 98 3e-21 gb|AGG68476.1| DELLA protein [Triticum aestivum] 98 3e-21 emb|CBW30291.1| RHT-D1 protein [Triticum aestivum] 98 3e-21 emb|CBW30290.1| RHT-D1 protein [Triticum aestivum] 98 3e-21 emb|CBW30289.1| RHT-D1 protein [Triticum aestivum] 98 3e-21 emb|CBW30288.1| RHT-D1 protein [Triticum aestivum] 98 3e-21 ref|XP_010916517.1| PREDICTED: DELLA protein SLR1 isoform X1 [El... 98 3e-21 ref|XP_008809806.1| PREDICTED: DELLA protein SLR1 [Phoenix dacty... 98 3e-21 emb|CBX87014.1| DELLA protein [Triticum aestivum] 97 3e-21 emb|CBI84063.1| DELLA protein RHT1 [Triticum aestivum] 97 3e-21 gb|AHK61037.1| DELLA protein, partial [Psathyrostachys huashanica] 97 4e-21 >gb|AAT08645.1| GAI-like protein, partial [Hyacinthus orientalis] Length = 215 Score = 98.2 bits (243), Expect = 5e-23 Identities = 45/48 (93%), Positives = 48/48 (100%) Frame = +1 Query: 1 SNAFKQASMLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRVAD 144 SNAFKQASMLLALFAGG+GY+VEEK+GCLTLGWHTRPLIATSAWRVAD Sbjct: 167 SNAFKQASMLLALFAGGNGYRVEEKDGCLTLGWHTRPLIATSAWRVAD 214 >ref|XP_009380281.1| PREDICTED: DELLA protein SLN1-like [Musa acuminata subsp. malaccensis] Length = 595 Score = 99.8 bits (247), Expect = 5e-22 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = +1 Query: 1 SNAFKQASMLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRVADP 147 SNAFKQASMLLALFAGGDGY+VEEK+GCLTLGWHTRPLIATSAWRVA P Sbjct: 536 SNAFKQASMLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRVAAP 584 >ref|XP_020584529.1| DELLA protein SLR1-like [Phalaenopsis equestris] Length = 603 Score = 99.0 bits (245), Expect = 1e-21 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +1 Query: 1 SNAFKQASMLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRVA 141 SNAFKQASMLLALFAGGDGY+VEEKEGCLTLGWHTRPLIATSAWRVA Sbjct: 542 SNAFKQASMLLALFAGGDGYRVEEKEGCLTLGWHTRPLIATSAWRVA 588 >ref|XP_009390245.1| PREDICTED: DELLA protein SLR1-like [Musa acuminata subsp. malaccensis] Length = 612 Score = 99.0 bits (245), Expect = 1e-21 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +1 Query: 1 SNAFKQASMLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRVA 141 SNAFKQASMLLALFAGGDGY+VEEKEGCLTLGWHTRPLIATSAWRVA Sbjct: 554 SNAFKQASMLLALFAGGDGYRVEEKEGCLTLGWHTRPLIATSAWRVA 600 >ref|XP_020682060.1| DELLA protein SLN1-like [Dendrobium catenatum] gb|PKU65304.1| DELLA protein DWARF8 [Dendrobium catenatum] Length = 647 Score = 99.0 bits (245), Expect = 1e-21 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +1 Query: 1 SNAFKQASMLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRVA 141 SNAFKQASMLLALFAGGDGY+VEEKEGCLTLGWHTRPLIATSAWRVA Sbjct: 588 SNAFKQASMLLALFAGGDGYRVEEKEGCLTLGWHTRPLIATSAWRVA 634 >ref|XP_010926472.1| PREDICTED: DELLA protein SLR1-like [Elaeis guineensis] Length = 651 Score = 99.0 bits (245), Expect = 1e-21 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +1 Query: 1 SNAFKQASMLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRVA 141 SNAFKQASMLLALFAGGDGY+VEEKEGCLTLGWHTRPLIATSAWRVA Sbjct: 592 SNAFKQASMLLALFAGGDGYRVEEKEGCLTLGWHTRPLIATSAWRVA 638 >gb|EMS65108.1| hypothetical protein TRIUR3_18790 [Triticum urartu] Length = 407 Score = 97.4 bits (241), Expect = 2e-21 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +1 Query: 1 SNAFKQASMLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRVADP 147 SNA+KQAS LLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWR+A P Sbjct: 359 SNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAAP 407 >gb|ADP02183.1| Rht-D1b [Triticum aestivum] Length = 559 Score = 97.8 bits (242), Expect = 3e-21 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +1 Query: 1 SNAFKQASMLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRVADP 147 SNA+KQAS LLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWR+A P Sbjct: 511 SNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAGP 559 >ref|XP_020147810.1| DELLA protein RHT-1 [Aegilops tauschii subsp. tauschii] gb|ADP02199.1| Rht-D1a [Aegilops tauschii] Length = 623 Score = 97.8 bits (242), Expect = 3e-21 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +1 Query: 1 SNAFKQASMLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRVADP 147 SNA+KQAS LLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWR+A P Sbjct: 575 SNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAGP 623 >sp|Q9ST59.1|RHT1_WHEAT RecName: Full=DELLA protein RHT-1; AltName: Full=Protein Rht-B1/Rht-D1; AltName: Full=Reduced height protein 1 emb|CAB51555.1| gibberellin response modulator [Triticum aestivum] gb|ADM32429.1| DELLA protein RHT-D1 [Triticum aestivum] gb|AFW04250.1| DELLA [Triticum aestivum] gb|AGG68473.1| DELLA protein [Triticum aestivum] gb|AGG68474.1| DELLA protein [Triticum aestivum] gb|AGG68475.1| DELLA protein [Triticum aestivum] gb|AGG68477.1| DELLA protein [Triticum aestivum] gb|AGG68546.1| DELLA protein [Triticum aestivum] gb|AGG68547.1| DELLA protein [Triticum aestivum] gb|AGG68548.1| DELLA protein [Triticum aestivum] gb|AGG68549.1| DELLA protein [Triticum aestivum] gb|AGG68550.1| DELLA protein [Triticum aestivum] gb|AGG68551.1| DELLA protein [Triticum aestivum] gb|AGG68552.1| DELLA protein [Triticum aestivum] gb|AGG68553.1| DELLA protein [Triticum aestivum] gb|AGG68554.1| DELLA protein [Triticum aestivum] gb|AGG68555.1| DELLA protein [Triticum aestivum] gb|AGG68556.1| DELLA protein [Triticum aestivum] gb|AGG68557.1| DELLA protein [Triticum aestivum] gb|AGG68558.1| DELLA protein [Triticum aestivum] gb|AGG68559.1| DELLA protein [Triticum aestivum] gb|AGG68560.1| DELLA protein [Triticum aestivum] gb|AGG68561.1| DELLA protein [Triticum aestivum] gb|AGG68562.1| DELLA protein [Triticum aestivum] gb|AGG68563.1| DELLA protein [Triticum aestivum] gb|AGG68564.1| DELLA protein [Triticum aestivum] gb|AGG68565.1| DELLA protein [Triticum aestivum] gb|AGQ43580.1| DELLA [Triticum aestivum] emb|CCD31544.1| DELLA protein [Triticum aestivum] Length = 623 Score = 97.8 bits (242), Expect = 3e-21 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +1 Query: 1 SNAFKQASMLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRVADP 147 SNA+KQAS LLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWR+A P Sbjct: 575 SNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAGP 623 >gb|AGG68476.1| DELLA protein [Triticum aestivum] Length = 623 Score = 97.8 bits (242), Expect = 3e-21 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +1 Query: 1 SNAFKQASMLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRVADP 147 SNA+KQAS LLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWR+A P Sbjct: 575 SNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAGP 623 >emb|CBW30291.1| RHT-D1 protein [Triticum aestivum] Length = 623 Score = 97.8 bits (242), Expect = 3e-21 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +1 Query: 1 SNAFKQASMLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRVADP 147 SNA+KQAS LLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWR+A P Sbjct: 575 SNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAGP 623 >emb|CBW30290.1| RHT-D1 protein [Triticum aestivum] Length = 623 Score = 97.8 bits (242), Expect = 3e-21 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +1 Query: 1 SNAFKQASMLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRVADP 147 SNA+KQAS LLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWR+A P Sbjct: 575 SNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAGP 623 >emb|CBW30289.1| RHT-D1 protein [Triticum aestivum] Length = 623 Score = 97.8 bits (242), Expect = 3e-21 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +1 Query: 1 SNAFKQASMLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRVADP 147 SNA+KQAS LLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWR+A P Sbjct: 575 SNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAGP 623 >emb|CBW30288.1| RHT-D1 protein [Triticum aestivum] Length = 623 Score = 97.8 bits (242), Expect = 3e-21 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +1 Query: 1 SNAFKQASMLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRVADP 147 SNA+KQAS LLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWR+A P Sbjct: 575 SNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAGP 623 >ref|XP_010916517.1| PREDICTED: DELLA protein SLR1 isoform X1 [Elaeis guineensis] ref|XP_010916518.1| PREDICTED: DELLA protein SLR1 isoform X2 [Elaeis guineensis] Length = 647 Score = 97.8 bits (242), Expect = 3e-21 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = +1 Query: 1 SNAFKQASMLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRVA 141 SNAFKQASMLLALFAGGDGY+VEEK+GCLTLGWHTRPLIATSAWRVA Sbjct: 592 SNAFKQASMLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRVA 638 >ref|XP_008809806.1| PREDICTED: DELLA protein SLR1 [Phoenix dactylifera] Length = 656 Score = 97.8 bits (242), Expect = 3e-21 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = +1 Query: 1 SNAFKQASMLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRVA 141 SNAFKQASMLLALFAGGDGY+VEEK+GCLTLGWHTRPLIATSAWRVA Sbjct: 600 SNAFKQASMLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRVA 646 >emb|CBX87014.1| DELLA protein [Triticum aestivum] Length = 555 Score = 97.4 bits (241), Expect = 3e-21 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +1 Query: 1 SNAFKQASMLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRVADP 147 SNA+KQAS LLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWR+A P Sbjct: 507 SNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAAP 555 >emb|CBI84063.1| DELLA protein RHT1 [Triticum aestivum] Length = 555 Score = 97.4 bits (241), Expect = 3e-21 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +1 Query: 1 SNAFKQASMLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRVADP 147 SNA+KQAS LLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWR+A P Sbjct: 507 SNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAAP 555 >gb|AHK61037.1| DELLA protein, partial [Psathyrostachys huashanica] Length = 617 Score = 97.4 bits (241), Expect = 4e-21 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +1 Query: 1 SNAFKQASMLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRVADP 147 SNA+KQAS LLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWR+A P Sbjct: 569 SNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAAP 617