BLASTX nr result
ID: Ophiopogon22_contig00017875
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00017875 (705 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020245820.1| phosphatidylinositol/phosphatidylcholine tra... 95 9e-19 ref|XP_020245819.1| phosphatidylinositol/phosphatidylcholine tra... 95 1e-18 ref|XP_008778054.1| PREDICTED: phosphatidylinositol/phosphatidyl... 88 2e-16 ref|XP_010909338.1| PREDICTED: phosphatidylinositol/phosphatidyl... 78 6e-13 gb|PKA57786.1| Patellin-4 [Apostasia shenzhenica] 73 2e-11 ref|XP_010274040.1| PREDICTED: phosphatidylinositol/phosphatidyl... 72 6e-11 gb|PIA36045.1| hypothetical protein AQUCO_03400146v1 [Aquilegia ... 67 4e-09 gb|PIA36042.1| hypothetical protein AQUCO_03400146v1 [Aquilegia ... 67 4e-09 ref|XP_018840710.1| PREDICTED: phosphatidylinositol/phosphatidyl... 66 7e-09 ref|XP_020552515.1| phosphatidylinositol/phosphatidylcholine tra... 66 1e-08 ref|XP_022851913.1| phosphatidylinositol/phosphatidylcholine tra... 65 1e-08 ref|XP_022851912.1| phosphatidylinositol/phosphatidylcholine tra... 65 1e-08 ref|XP_022851909.1| phosphatidylinositol/phosphatidylcholine tra... 65 1e-08 ref|XP_021678169.1| phosphatidylinositol/phosphatidylcholine tra... 65 2e-08 ref|XP_009415954.1| PREDICTED: phosphatidylinositol/phosphatidyl... 65 2e-08 ref|XP_012085100.1| phosphatidylinositol/phosphatidylcholine tra... 65 2e-08 emb|CDP03879.1| unnamed protein product [Coffea canephora] 65 2e-08 ref|XP_017611742.1| PREDICTED: phosphatidylinositol/phosphatidyl... 64 3e-08 gb|KJB10165.1| hypothetical protein B456_001G187000 [Gossypium r... 64 3e-08 ref|XP_016746475.1| PREDICTED: phosphatidylinositol/phosphatidyl... 64 3e-08 >ref|XP_020245820.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH9-like isoform X2 [Asparagus officinalis] Length = 469 Score = 94.7 bits (234), Expect = 9e-19 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = +2 Query: 2 RIKSIEYDLQKTKSALSATSLKQEELAESLEHLKQTSIQRRSCWFNDCKSLQPE 163 RIKSIEYDLQKTK+ALSA+SL+QEELAESLE LKQTS+QR+SCWFND SLQPE Sbjct: 401 RIKSIEYDLQKTKNALSASSLRQEELAESLEFLKQTSVQRKSCWFNDRNSLQPE 454 >ref|XP_020245819.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH9-like isoform X1 [Asparagus officinalis] gb|ONK58213.1| uncharacterized protein A4U43_C09F9650 [Asparagus officinalis] Length = 534 Score = 94.7 bits (234), Expect = 1e-18 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = +2 Query: 2 RIKSIEYDLQKTKSALSATSLKQEELAESLEHLKQTSIQRRSCWFNDCKSLQPE 163 RIKSIEYDLQKTK+ALSA+SL+QEELAESLE LKQTS+QR+SCWFND SLQPE Sbjct: 466 RIKSIEYDLQKTKNALSASSLRQEELAESLEFLKQTSVQRKSCWFNDRNSLQPE 519 >ref|XP_008778054.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH9-like [Phoenix dactylifera] Length = 473 Score = 88.2 bits (217), Expect = 2e-16 Identities = 42/52 (80%), Positives = 47/52 (90%) Frame = +2 Query: 2 RIKSIEYDLQKTKSALSATSLKQEELAESLEHLKQTSIQRRSCWFNDCKSLQ 157 RIKSIEYDLQKTK AL+ATSL+Q ELAESLE+LK+TS+ R SCWF DCKSLQ Sbjct: 419 RIKSIEYDLQKTKDALNATSLRQVELAESLENLKETSLHRNSCWFKDCKSLQ 470 >ref|XP_010909338.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH9-like [Elaeis guineensis] Length = 555 Score = 78.2 bits (191), Expect = 6e-13 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = +2 Query: 2 RIKSIEYDLQKTKSALSATSLKQEELAESLEHLKQTSIQRRSCWFNDCKSLQ 157 RIKSIEYDLQKTK AL+ATS +Q ELAE LE+LK++S+ R SCWF D KSLQ Sbjct: 501 RIKSIEYDLQKTKEALNATSSRQVELAELLENLKESSLHRNSCWFKDSKSLQ 552 >gb|PKA57786.1| Patellin-4 [Apostasia shenzhenica] Length = 357 Score = 73.2 bits (178), Expect = 2e-11 Identities = 32/49 (65%), Positives = 43/49 (87%) Frame = +2 Query: 2 RIKSIEYDLQKTKSALSATSLKQEELAESLEHLKQTSIQRRSCWFNDCK 148 RI+SIE+DL+KTK L+ATS++Q+ELAESLEH+K+T +QR+SCW N K Sbjct: 307 RIRSIEHDLRKTKDTLTATSIRQDELAESLEHIKETGLQRKSCWPNGAK 355 >ref|XP_010274040.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH9 [Nelumbo nucifera] Length = 605 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/54 (68%), Positives = 43/54 (79%), Gaps = 1/54 (1%) Frame = +2 Query: 2 RIKSIEYDLQKTKSALSATSLKQEELAESLEHLKQTSIQRR-SCWFNDCKSLQP 160 RIKSIE+DLQKTK AL AT+ KQ ELAESLE+LK+ + +R SCW DCKSL P Sbjct: 550 RIKSIEHDLQKTKKALHATASKQVELAESLENLKEPRLNKRNSCWSGDCKSLPP 603 >gb|PIA36045.1| hypothetical protein AQUCO_03400146v1 [Aquilegia coerulea] Length = 480 Score = 67.0 bits (162), Expect = 4e-09 Identities = 34/48 (70%), Positives = 40/48 (83%), Gaps = 1/48 (2%) Frame = +2 Query: 2 RIKSIEYDLQKTKSALSATSLKQEELAESLEHLKQTSIQRR-SCWFND 142 RIKSIEYDLQKT+ AL AT+ KQ ELAESLE+LK++S+ RR SCW D Sbjct: 433 RIKSIEYDLQKTRKALHATASKQVELAESLENLKESSLSRRNSCWLRD 480 >gb|PIA36042.1| hypothetical protein AQUCO_03400146v1 [Aquilegia coerulea] gb|PIA36043.1| hypothetical protein AQUCO_03400146v1 [Aquilegia coerulea] gb|PIA36044.1| hypothetical protein AQUCO_03400146v1 [Aquilegia coerulea] Length = 564 Score = 67.0 bits (162), Expect = 4e-09 Identities = 34/48 (70%), Positives = 40/48 (83%), Gaps = 1/48 (2%) Frame = +2 Query: 2 RIKSIEYDLQKTKSALSATSLKQEELAESLEHLKQTSIQRR-SCWFND 142 RIKSIEYDLQKT+ AL AT+ KQ ELAESLE+LK++S+ RR SCW D Sbjct: 517 RIKSIEYDLQKTRKALHATASKQVELAESLENLKESSLSRRNSCWLRD 564 >ref|XP_018840710.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH9-like isoform X1 [Juglans regia] Length = 602 Score = 66.2 bits (160), Expect = 7e-09 Identities = 35/51 (68%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = +2 Query: 2 RIKSIEYDLQKTKSALSATSLKQEELAESLEHLKQTSIQ-RRSCWFNDCKS 151 RIKSIEYDLQKTK AL AT+ KQ ELA+SLE LK S+ +RSCW +CKS Sbjct: 547 RIKSIEYDLQKTKKALLATASKQVELADSLESLKDDSLTGKRSCWPRNCKS 597 >ref|XP_020552515.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH9-like isoform X2 [Sesamum indicum] Length = 605 Score = 65.9 bits (159), Expect = 1e-08 Identities = 35/52 (67%), Positives = 41/52 (78%), Gaps = 1/52 (1%) Frame = +2 Query: 2 RIKSIEYDLQKTKSALSATSLKQEELAESLEHLKQTSIQ-RRSCWFNDCKSL 154 RIKSIEYDLQKTK AL AT+ KQEEL+ESLE LK+ +I+ +SCW KSL Sbjct: 550 RIKSIEYDLQKTKKALLATTSKQEELSESLEILKEINIKATKSCWLRSSKSL 601 >ref|XP_022851913.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH9-like isoform X3 [Olea europaea var. sylvestris] Length = 589 Score = 65.5 bits (158), Expect = 1e-08 Identities = 35/54 (64%), Positives = 41/54 (75%), Gaps = 1/54 (1%) Frame = +2 Query: 2 RIKSIEYDLQKTKSALSATSLKQEELAESLEHLKQTSIQ-RRSCWFNDCKSLQP 160 RIKSIE+DLQKTK AL AT+ KQ EL+ESLE LK++S+ RSCW KSL P Sbjct: 534 RIKSIEHDLQKTKKALFATTSKQLELSESLETLKESSLNGTRSCWLQSSKSLPP 587 >ref|XP_022851912.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH9-like isoform X2 [Olea europaea var. sylvestris] Length = 591 Score = 65.5 bits (158), Expect = 1e-08 Identities = 35/54 (64%), Positives = 41/54 (75%), Gaps = 1/54 (1%) Frame = +2 Query: 2 RIKSIEYDLQKTKSALSATSLKQEELAESLEHLKQTSIQ-RRSCWFNDCKSLQP 160 RIKSIE+DLQKTK AL AT+ KQ EL+ESLE LK++S+ RSCW KSL P Sbjct: 536 RIKSIEHDLQKTKKALFATTSKQLELSESLETLKESSLNGTRSCWLQSSKSLPP 589 >ref|XP_022851909.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH9-like isoform X1 [Olea europaea var. sylvestris] ref|XP_022851911.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH9-like isoform X1 [Olea europaea var. sylvestris] Length = 592 Score = 65.5 bits (158), Expect = 1e-08 Identities = 35/54 (64%), Positives = 41/54 (75%), Gaps = 1/54 (1%) Frame = +2 Query: 2 RIKSIEYDLQKTKSALSATSLKQEELAESLEHLKQTSIQ-RRSCWFNDCKSLQP 160 RIKSIE+DLQKTK AL AT+ KQ EL+ESLE LK++S+ RSCW KSL P Sbjct: 537 RIKSIEHDLQKTKKALFATTSKQLELSESLETLKESSLNGTRSCWLQSSKSLPP 590 >ref|XP_021678169.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH9-like [Hevea brasiliensis] Length = 598 Score = 65.1 bits (157), Expect = 2e-08 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = +2 Query: 2 RIKSIEYDLQKTKSALSATSLKQEELAESLEHLKQTSIQR-RSCWFNDCKSLQPE 163 RIKSIE+DLQKTK AL AT+ KQ ELAES E+LK++++ SCW +CK+ PE Sbjct: 543 RIKSIEHDLQKTKKALLATASKQVELAESFENLKESTLAGVNSCWPRNCKTFSPE 597 >ref|XP_009415954.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH9-like [Musa acuminata subsp. malaccensis] Length = 558 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/49 (61%), Positives = 38/49 (77%) Frame = +2 Query: 2 RIKSIEYDLQKTKSALSATSLKQEELAESLEHLKQTSIQRRSCWFNDCK 148 RI+SIE+DLQKTK + TS KQ EL ESL+ L++T+ Q +SCWF DCK Sbjct: 499 RIQSIEHDLQKTKDVVKVTSQKQIELEESLDILRETASQVKSCWFKDCK 547 >ref|XP_012085100.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH9 [Jatropha curcas] ref|XP_012085101.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH9 [Jatropha curcas] gb|KDP26382.1| hypothetical protein JCGZ_17540 [Jatropha curcas] Length = 597 Score = 64.7 bits (156), Expect = 2e-08 Identities = 34/55 (61%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = +2 Query: 2 RIKSIEYDLQKTKSALSATSLKQEELAESLEHLKQTSIQR-RSCWFNDCKSLQPE 163 RI+SIEYDLQKTK AL AT+ KQ ELAESLE+LK++++ SCW CK PE Sbjct: 542 RIRSIEYDLQKTKKALLATASKQVELAESLENLKESALAGVNSCWPRYCKPFPPE 596 >emb|CDP03879.1| unnamed protein product [Coffea canephora] Length = 598 Score = 64.7 bits (156), Expect = 2e-08 Identities = 35/52 (67%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = +2 Query: 2 RIKSIEYDLQKTKSALSATSLKQEELAESLEHLKQTSIQ-RRSCWFNDCKSL 154 RIKSIEYDLQKTK AL AT+ KQ ELAESLE L+++SI+ SCW KSL Sbjct: 538 RIKSIEYDLQKTKKALLATASKQVELAESLESLRESSIRATSSCWLRSSKSL 589 >ref|XP_017611742.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH9-like isoform X7 [Gossypium arboreum] Length = 557 Score = 64.3 bits (155), Expect = 3e-08 Identities = 35/54 (64%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = +2 Query: 2 RIKSIEYDLQKTKSALSATSLKQEELAESLEHLKQTSIQ-RRSCWFNDCKSLQP 160 RIKSIE DLQ+TK AL AT+ KQ ELAESLEHLK+TS+ SCW + K L P Sbjct: 502 RIKSIEQDLQRTKKALLATASKQVELAESLEHLKETSLAGTYSCWRRNYKPLNP 555 >gb|KJB10165.1| hypothetical protein B456_001G187000 [Gossypium raimondii] Length = 557 Score = 64.3 bits (155), Expect = 3e-08 Identities = 35/54 (64%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = +2 Query: 2 RIKSIEYDLQKTKSALSATSLKQEELAESLEHLKQTSIQ-RRSCWFNDCKSLQP 160 RIKSIE DLQ+TK AL AT+ KQ ELAESLEHLK+TS+ SCW + K L P Sbjct: 502 RIKSIEQDLQRTKKALLATASKQVELAESLEHLKETSLAGTYSCWRRNYKPLNP 555 >ref|XP_016746475.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH9-like isoform X8 [Gossypium hirsutum] Length = 599 Score = 64.3 bits (155), Expect = 3e-08 Identities = 35/54 (64%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = +2 Query: 2 RIKSIEYDLQKTKSALSATSLKQEELAESLEHLKQTSIQ-RRSCWFNDCKSLQP 160 RIKSIE DLQ+TK AL AT+ KQ ELAESLEHLK+TS+ SCW + K L P Sbjct: 544 RIKSIEQDLQRTKKALLATASKQVELAESLEHLKETSLAGTYSCWRRNYKPLNP 597