BLASTX nr result
ID: Ophiopogon22_contig00017761
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00017761 (903 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK59320.1| uncharacterized protein A4U43_C08F5230 [Asparagus... 54 5e-06 >gb|ONK59320.1| uncharacterized protein A4U43_C08F5230 [Asparagus officinalis] Length = 83 Score = 54.3 bits (129), Expect = 5e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -3 Query: 808 LLDEEEAIFCDTKVDNHGEPLEFSSG*GFV 719 LLDEEE IF DTKVDNHGEPLEFSSG G V Sbjct: 47 LLDEEEIIFYDTKVDNHGEPLEFSSGEGLV 76