BLASTX nr result
ID: Ophiopogon22_contig00017669
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00017669 (381 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242366.1| monothiol glutaredoxin-S15, mitochondrial is... 82 5e-17 ref|XP_020242365.1| monothiol glutaredoxin-S15, mitochondrial is... 82 5e-17 gb|PKA55202.1| Monothiol glutaredoxin-S4, mitochondrial [Apostas... 81 8e-17 ref|XP_020105263.1| monothiol glutaredoxin-S4, mitochondrial-lik... 81 9e-17 gb|OAY76167.1| Monothiol glutaredoxin-S4, mitochondrial [Ananas ... 81 1e-16 gb|OAY82719.1| Monothiol glutaredoxin-S4, mitochondrial [Ananas ... 81 1e-16 ref|XP_020685906.1| monothiol glutaredoxin-S15, mitochondrial [D... 79 1e-15 gb|KRH23550.1| hypothetical protein GLYMA_13G363100 [Glycine max] 77 4e-15 gb|KHN44157.1| Monothiol glutaredoxin-S15, mitochondrial [Glycin... 77 5e-15 ref|NP_001237415.1| uncharacterized protein LOC100306093 [Glycin... 77 5e-15 gb|KDO52892.1| hypothetical protein CISIN_1g0308901mg, partial [... 74 5e-15 ref|XP_018827597.1| PREDICTED: monothiol glutaredoxin-S15, mitoc... 77 5e-15 ref|XP_014632805.1| PREDICTED: uncharacterized protein LOC100500... 76 9e-15 gb|KRH47491.1| hypothetical protein GLYMA_07G032600 [Glycine max... 76 9e-15 gb|KHN01349.1| Monothiol glutaredoxin-S15, mitochondrial [Glycin... 76 9e-15 ref|XP_002517580.1| PREDICTED: monothiol glutaredoxin-S15, mitoc... 76 1e-14 ref|XP_004302955.1| PREDICTED: monothiol glutaredoxin-S15, mitoc... 76 1e-14 gb|ABE68717.1| glutaredoxin, partial [Arachis hypogaea] 74 1e-14 ref|XP_024026100.1| monothiol glutaredoxin-S15, mitochondrial [M... 75 2e-14 gb|AFK34820.1| unknown [Medicago truncatula] 73 2e-14 >ref|XP_020242366.1| monothiol glutaredoxin-S15, mitochondrial isoform X2 [Asparagus officinalis] gb|ONK59502.1| uncharacterized protein A4U43_C08F7090 [Asparagus officinalis] Length = 169 Score = 82.0 bits (201), Expect = 5e-17 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -3 Query: 379 RNILENPQLKEGVKAFSNWPTFPQVFIKGEFIGGSDIVL 263 RNILENP+LKEGVKAFSNWPTFPQVFIKGEF+GGSDIVL Sbjct: 108 RNILENPRLKEGVKAFSNWPTFPQVFIKGEFVGGSDIVL 146 >ref|XP_020242365.1| monothiol glutaredoxin-S15, mitochondrial isoform X1 [Asparagus officinalis] Length = 170 Score = 82.0 bits (201), Expect = 5e-17 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -3 Query: 379 RNILENPQLKEGVKAFSNWPTFPQVFIKGEFIGGSDIVL 263 RNILENP+LKEGVKAFSNWPTFPQVFIKGEF+GGSDIVL Sbjct: 109 RNILENPRLKEGVKAFSNWPTFPQVFIKGEFVGGSDIVL 147 >gb|PKA55202.1| Monothiol glutaredoxin-S4, mitochondrial [Apostasia shenzhenica] Length = 164 Score = 81.3 bits (199), Expect = 8e-17 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -3 Query: 379 RNILENPQLKEGVKAFSNWPTFPQVFIKGEFIGGSDIVL 263 RNILENP LKEGVKAFSNWPTFPQVFIKGEF+GGSDIVL Sbjct: 104 RNILENPALKEGVKAFSNWPTFPQVFIKGEFVGGSDIVL 142 >ref|XP_020105263.1| monothiol glutaredoxin-S4, mitochondrial-like [Ananas comosus] ref|XP_020105264.1| monothiol glutaredoxin-S4, mitochondrial-like [Ananas comosus] Length = 166 Score = 81.3 bits (199), Expect = 9e-17 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -3 Query: 379 RNILENPQLKEGVKAFSNWPTFPQVFIKGEFIGGSDIVL 263 RNILENP+LKEGVKA+SNWPTFPQVFIKGEF+GGSDIVL Sbjct: 106 RNILENPELKEGVKAYSNWPTFPQVFIKGEFVGGSDIVL 144 >gb|OAY76167.1| Monothiol glutaredoxin-S4, mitochondrial [Ananas comosus] Length = 174 Score = 81.3 bits (199), Expect = 1e-16 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -3 Query: 379 RNILENPQLKEGVKAFSNWPTFPQVFIKGEFIGGSDIVL 263 RNILENP+LKEGVKA+SNWPTFPQVFIKGEF+GGSDIVL Sbjct: 114 RNILENPELKEGVKAYSNWPTFPQVFIKGEFVGGSDIVL 152 >gb|OAY82719.1| Monothiol glutaredoxin-S4, mitochondrial [Ananas comosus] Length = 180 Score = 81.3 bits (199), Expect = 1e-16 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -3 Query: 379 RNILENPQLKEGVKAFSNWPTFPQVFIKGEFIGGSDIVL 263 RNILENP+LKEGVKA+SNWPTFPQVFIKGEF+GGSDIVL Sbjct: 120 RNILENPELKEGVKAYSNWPTFPQVFIKGEFVGGSDIVL 158 >ref|XP_020685906.1| monothiol glutaredoxin-S15, mitochondrial [Dendrobium catenatum] ref|XP_020685907.1| monothiol glutaredoxin-S15, mitochondrial [Dendrobium catenatum] gb|PKU83482.1| Monothiol glutaredoxin-S15, mitochondrial [Dendrobium catenatum] Length = 170 Score = 78.6 bits (192), Expect = 1e-15 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -3 Query: 379 RNILENPQLKEGVKAFSNWPTFPQVFIKGEFIGGSDIVL 263 RNILE+P LKEGVKAFSNWPTFPQ+F+KGEFIGGSDIVL Sbjct: 107 RNILEDPVLKEGVKAFSNWPTFPQIFVKGEFIGGSDIVL 145 >gb|KRH23550.1| hypothetical protein GLYMA_13G363100 [Glycine max] Length = 157 Score = 76.6 bits (187), Expect = 4e-15 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -3 Query: 379 RNILENPQLKEGVKAFSNWPTFPQVFIKGEFIGGSDIVL 263 RNILE+P+LK VKAFSNWPTFPQVFIKGEFIGGSDIVL Sbjct: 100 RNILEDPELKNAVKAFSNWPTFPQVFIKGEFIGGSDIVL 138 >gb|KHN44157.1| Monothiol glutaredoxin-S15, mitochondrial [Glycine soja] Length = 162 Score = 76.6 bits (187), Expect = 5e-15 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -3 Query: 379 RNILENPQLKEGVKAFSNWPTFPQVFIKGEFIGGSDIVL 263 RNILE+P+LK VKAFSNWPTFPQVFIKGEFIGGSDIVL Sbjct: 105 RNILEDPELKNAVKAFSNWPTFPQVFIKGEFIGGSDIVL 143 >ref|NP_001237415.1| uncharacterized protein LOC100306093 [Glycine max] gb|ACU14106.1| unknown [Glycine max] gb|KRH23549.1| hypothetical protein GLYMA_13G363100 [Glycine max] Length = 162 Score = 76.6 bits (187), Expect = 5e-15 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -3 Query: 379 RNILENPQLKEGVKAFSNWPTFPQVFIKGEFIGGSDIVL 263 RNILE+P+LK VKAFSNWPTFPQVFIKGEFIGGSDIVL Sbjct: 105 RNILEDPELKNAVKAFSNWPTFPQVFIKGEFIGGSDIVL 143 >gb|KDO52892.1| hypothetical protein CISIN_1g0308901mg, partial [Citrus sinensis] gb|KDO52893.1| hypothetical protein CISIN_1g0308901mg, partial [Citrus sinensis] Length = 66 Score = 73.9 bits (180), Expect = 5e-15 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -3 Query: 379 RNILENPQLKEGVKAFSNWPTFPQVFIKGEFIGGSDIVL 263 RNILE+P+LK VKAFS+WPTFPQ+FIKGEFIGGSDI+L Sbjct: 6 RNILEDPELKSAVKAFSHWPTFPQIFIKGEFIGGSDIIL 44 >ref|XP_018827597.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial [Juglans regia] ref|XP_018827598.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial [Juglans regia] ref|XP_018827599.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial [Juglans regia] Length = 167 Score = 76.6 bits (187), Expect = 5e-15 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -3 Query: 379 RNILENPQLKEGVKAFSNWPTFPQVFIKGEFIGGSDIVL 263 RNILENP+LK VK+FSNWPTFPQ+FIKGEFIGGSDI+L Sbjct: 106 RNILENPELKSAVKSFSNWPTFPQIFIKGEFIGGSDIIL 144 >ref|XP_014632805.1| PREDICTED: uncharacterized protein LOC100500103 isoform X1 [Glycine max] gb|KRH47493.1| hypothetical protein GLYMA_07G032600 [Glycine max] Length = 159 Score = 75.9 bits (185), Expect = 9e-15 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -3 Query: 379 RNILENPQLKEGVKAFSNWPTFPQVFIKGEFIGGSDIVL 263 RNILE+P+LK VKAFSNWPTFPQ+FIKGEFIGGSDI+L Sbjct: 102 RNILEDPELKNAVKAFSNWPTFPQIFIKGEFIGGSDIIL 140 >gb|KRH47491.1| hypothetical protein GLYMA_07G032600 [Glycine max] gb|KRH47492.1| hypothetical protein GLYMA_07G032600 [Glycine max] Length = 161 Score = 75.9 bits (185), Expect = 9e-15 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -3 Query: 379 RNILENPQLKEGVKAFSNWPTFPQVFIKGEFIGGSDIVL 263 RNILE+P+LK VKAFSNWPTFPQ+FIKGEFIGGSDI+L Sbjct: 104 RNILEDPELKNAVKAFSNWPTFPQIFIKGEFIGGSDIIL 142 >gb|KHN01349.1| Monothiol glutaredoxin-S15, mitochondrial [Glycine soja] Length = 161 Score = 75.9 bits (185), Expect = 9e-15 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -3 Query: 379 RNILENPQLKEGVKAFSNWPTFPQVFIKGEFIGGSDIVL 263 RNILE+P+LK VKAFSNWPTFPQ+FIKGEFIGGSDI+L Sbjct: 104 RNILEDPELKNAVKAFSNWPTFPQIFIKGEFIGGSDIIL 142 >ref|XP_002517580.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial [Ricinus communis] ref|XP_015573806.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial [Ricinus communis] gb|EEF44744.1| Monothiol glutaredoxin-4, putative [Ricinus communis] Length = 169 Score = 75.9 bits (185), Expect = 1e-14 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -3 Query: 379 RNILENPQLKEGVKAFSNWPTFPQVFIKGEFIGGSDIVL 263 RNILENP+LK VK+FSNWPTFPQ+FIKGEFIGGSDI++ Sbjct: 109 RNILENPELKSAVKSFSNWPTFPQIFIKGEFIGGSDIIM 147 >ref|XP_004302955.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial [Fragaria vesca subsp. vesca] Length = 172 Score = 75.9 bits (185), Expect = 1e-14 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -3 Query: 379 RNILENPQLKEGVKAFSNWPTFPQVFIKGEFIGGSDIVL 263 RNILE+P+LK VKAFSNWPTFPQ+FIKGEFIGGSDI+L Sbjct: 111 RNILEDPELKNAVKAFSNWPTFPQIFIKGEFIGGSDIIL 149 >gb|ABE68717.1| glutaredoxin, partial [Arachis hypogaea] Length = 117 Score = 74.3 bits (181), Expect = 1e-14 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -3 Query: 379 RNILENPQLKEGVKAFSNWPTFPQVFIKGEFIGGSDIVL 263 RNILE+P+LK VKAFS+WPTFPQVFIKGEFIGGSDI+L Sbjct: 60 RNILEDPELKSAVKAFSHWPTFPQVFIKGEFIGGSDIIL 98 >ref|XP_024026100.1| monothiol glutaredoxin-S15, mitochondrial [Morus notabilis] Length = 169 Score = 75.5 bits (184), Expect = 2e-14 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -3 Query: 379 RNILENPQLKEGVKAFSNWPTFPQVFIKGEFIGGSDIVL 263 RNILENP+LK VKAFS WPTFPQ+FIKGEFIGGSDI+L Sbjct: 108 RNILENPELKSAVKAFSQWPTFPQIFIKGEFIGGSDIIL 146 >gb|AFK34820.1| unknown [Medicago truncatula] Length = 90 Score = 73.2 bits (178), Expect = 2e-14 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = -3 Query: 379 RNILENPQLKEGVKAFSNWPTFPQVFIKGEFIGGSDIVL 263 RNIL++P++K+ VKAFS+WPTFPQVFIKGEFIGGSDIVL Sbjct: 33 RNILQDPEVKDAVKAFSHWPTFPQVFIKGEFIGGSDIVL 71