BLASTX nr result
ID: Ophiopogon22_contig00017583
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00017583 (427 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009385573.2| PREDICTED: probable calcium-binding protein ... 69 5e-14 ref|XP_009413529.1| PREDICTED: probable calcium-binding protein ... 69 5e-14 ref|XP_015056260.1| PREDICTED: probable calcium-binding protein ... 70 8e-14 ref|XP_004249218.1| PREDICTED: probable calcium-binding protein ... 70 8e-14 ref|XP_022888272.1| probable calcium-binding protein CML49 [Olea... 69 8e-14 ref|XP_002534120.1| PREDICTED: probable calcium-binding protein ... 69 8e-14 ref|XP_020241661.1| probable calcium-binding protein CML49 [Aspa... 69 8e-14 emb|CDP14167.1| unnamed protein product [Coffea canephora] 70 1e-13 ref|XP_010452313.1| PREDICTED: probable calcium-binding protein ... 69 2e-13 ref|XP_010490922.1| PREDICTED: probable calcium-binding protein ... 69 2e-13 ref|XP_006351292.1| PREDICTED: probable calcium-binding protein ... 70 2e-13 ref|XP_002450240.1| probable calcium-binding protein CML50 isofo... 68 2e-13 ref|NP_001147282.1| grancalcin [Zea mays] >gi|195609464|gb|ACG26... 68 2e-13 dbj|GAV89367.1| EF_hand_4 domain-containing protein [Cephalotus ... 68 2e-13 gb|AQK57284.1| putative calcium-binding protein CML50 [Zea mays] 68 2e-13 ref|XP_003535891.2| PREDICTED: probable calcium-binding protein ... 68 2e-13 ref|XP_021317104.1| probable calcium-binding protein CML49 isofo... 68 2e-13 gb|ACN31166.1| unknown [Zea mays] 68 2e-13 emb|CDY41394.1| BnaCnng10300D [Brassica napus] 69 2e-13 ref|XP_013724647.1| probable calcium-binding protein CML50 isofo... 69 2e-13 >ref|XP_009385573.2| PREDICTED: probable calcium-binding protein CML49 [Musa acuminata subsp. malaccensis] Length = 301 Score = 68.9 bits (167), Expect(2) = 5e-14 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 378 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 277 GLTEKFKEKDT YSGSATFTYESFMLTVLPFLIA Sbjct: 268 GLTEKFKEKDTKYSGSATFTYESFMLTVLPFLIA 301 Score = 36.2 bits (82), Expect(2) = 5e-14 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 425 KSGGKSKAIEYDNFIE 378 KSGGKSKAIEYDNFIE Sbjct: 246 KSGGKSKAIEYDNFIE 261 >ref|XP_009413529.1| PREDICTED: probable calcium-binding protein CML49 [Musa acuminata subsp. malaccensis] Length = 279 Score = 68.9 bits (167), Expect(2) = 5e-14 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 378 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 277 GLTEKFKEKDT YSGSATFTYESFMLTVLPFLIA Sbjct: 246 GLTEKFKEKDTQYSGSATFTYESFMLTVLPFLIA 279 Score = 36.2 bits (82), Expect(2) = 5e-14 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 425 KSGGKSKAIEYDNFIE 378 KSGGKSKAIEYDNFIE Sbjct: 224 KSGGKSKAIEYDNFIE 239 >ref|XP_015056260.1| PREDICTED: probable calcium-binding protein CML49 [Solanum pennellii] Length = 340 Score = 70.5 bits (171), Expect(2) = 8e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 378 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 277 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA Sbjct: 307 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 340 Score = 33.9 bits (76), Expect(2) = 8e-14 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = -3 Query: 425 KSGGKSKAIEYDNFIE 378 K+GGKS+AIEYDNFIE Sbjct: 285 KTGGKSRAIEYDNFIE 300 >ref|XP_004249218.1| PREDICTED: probable calcium-binding protein CML49 [Solanum lycopersicum] Length = 340 Score = 70.5 bits (171), Expect(2) = 8e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 378 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 277 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA Sbjct: 307 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 340 Score = 33.9 bits (76), Expect(2) = 8e-14 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = -3 Query: 425 KSGGKSKAIEYDNFIE 378 K+GGKS+AIEYDNFIE Sbjct: 285 KTGGKSRAIEYDNFIE 300 >ref|XP_022888272.1| probable calcium-binding protein CML49 [Olea europaea var. sylvestris] Length = 283 Score = 69.3 bits (168), Expect(2) = 8e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 378 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 277 GLTEKFKEKDT+YSGSATFTYESFMLTVLPFLIA Sbjct: 250 GLTEKFKEKDTAYSGSATFTYESFMLTVLPFLIA 283 Score = 35.0 bits (79), Expect(2) = 8e-14 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 425 KSGGKSKAIEYDNFIE 378 KSGGK+KAIEYDNFIE Sbjct: 228 KSGGKNKAIEYDNFIE 243 >ref|XP_002534120.1| PREDICTED: probable calcium-binding protein CML49 [Ricinus communis] gb|EEF28264.1| ef-hand calcium binding protein, putative [Ricinus communis] Length = 266 Score = 69.3 bits (168), Expect(2) = 8e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 378 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 277 GLTEKFKEKDTSYSGSATFTYE+FMLTVLPFLIA Sbjct: 233 GLTEKFKEKDTSYSGSATFTYEAFMLTVLPFLIA 266 Score = 35.0 bits (79), Expect(2) = 8e-14 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 425 KSGGKSKAIEYDNFIE 378 K+GGKSKAIEYDNFIE Sbjct: 211 KTGGKSKAIEYDNFIE 226 >ref|XP_020241661.1| probable calcium-binding protein CML49 [Asparagus officinalis] gb|ONK61470.1| uncharacterized protein A4U43_C08F30250 [Asparagus officinalis] Length = 187 Score = 69.3 bits (168), Expect(2) = 8e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 378 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 277 GLTEKFKEKDT+YSGSATFTYESFMLTVLPFLIA Sbjct: 154 GLTEKFKEKDTAYSGSATFTYESFMLTVLPFLIA 187 Score = 35.0 bits (79), Expect(2) = 8e-14 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 425 KSGGKSKAIEYDNFIE 378 K+GGKSKAIEYDNFIE Sbjct: 132 KTGGKSKAIEYDNFIE 147 >emb|CDP14167.1| unnamed protein product [Coffea canephora] Length = 300 Score = 70.5 bits (171), Expect(2) = 1e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 378 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 277 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA Sbjct: 267 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 300 Score = 33.1 bits (74), Expect(2) = 1e-13 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 425 KSGGKSKAIEYDNFIE 378 K+GGKS AIEYDNFIE Sbjct: 245 KTGGKSNAIEYDNFIE 260 >ref|XP_010452313.1| PREDICTED: probable calcium-binding protein CML50 [Camelina sativa] ref|XP_010452314.1| PREDICTED: probable calcium-binding protein CML50 [Camelina sativa] Length = 358 Score = 69.3 bits (168), Expect(2) = 2e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 378 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 277 GLTEKFKEKDTSYSGSATFTYE+FMLTVLPFLIA Sbjct: 325 GLTEKFKEKDTSYSGSATFTYETFMLTVLPFLIA 358 Score = 33.9 bits (76), Expect(2) = 2e-13 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = -3 Query: 425 KSGGKSKAIEYDNFIE 378 KSGGK++AIEYDNFIE Sbjct: 303 KSGGKNRAIEYDNFIE 318 >ref|XP_010490922.1| PREDICTED: probable calcium-binding protein CML50 [Camelina sativa] ref|XP_010490923.1| PREDICTED: probable calcium-binding protein CML50 [Camelina sativa] Length = 354 Score = 69.3 bits (168), Expect(2) = 2e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 378 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 277 GLTEKFKEKDTSYSGSATFTYE+FMLTVLPFLIA Sbjct: 321 GLTEKFKEKDTSYSGSATFTYETFMLTVLPFLIA 354 Score = 33.9 bits (76), Expect(2) = 2e-13 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = -3 Query: 425 KSGGKSKAIEYDNFIE 378 KSGGK++AIEYDNFIE Sbjct: 299 KSGGKNRAIEYDNFIE 314 >ref|XP_006351292.1| PREDICTED: probable calcium-binding protein CML49 [Solanum tuberosum] Length = 344 Score = 70.5 bits (171), Expect(2) = 2e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -2 Query: 378 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 277 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA Sbjct: 311 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 344 Score = 32.7 bits (73), Expect(2) = 2e-13 Identities = 13/16 (81%), Positives = 16/16 (100%) Frame = -3 Query: 425 KSGGKSKAIEYDNFIE 378 K+GGK++AIEYDNFIE Sbjct: 289 KTGGKNRAIEYDNFIE 304 >ref|XP_002450240.1| probable calcium-binding protein CML50 isoform X1 [Sorghum bicolor] gb|EES09228.1| hypothetical protein SORBI_3005G028700 [Sorghum bicolor] Length = 304 Score = 68.2 bits (165), Expect(2) = 2e-13 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -2 Query: 378 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 277 GLTEKFKEKDT+YSGSATFTYE+FMLTVLPFLIA Sbjct: 271 GLTEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 304 Score = 35.0 bits (79), Expect(2) = 2e-13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 425 KSGGKSKAIEYDNFIE 378 K+GGKSKAIEYDNFIE Sbjct: 249 KTGGKSKAIEYDNFIE 264 >ref|NP_001147282.1| grancalcin [Zea mays] gb|ACG26562.1| grancalcin [Zea mays] Length = 301 Score = 68.2 bits (165), Expect(2) = 2e-13 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -2 Query: 378 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 277 GLTEKFKEKDT+YSGSATFTYE+FMLTVLPFLIA Sbjct: 268 GLTEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 301 Score = 35.0 bits (79), Expect(2) = 2e-13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 425 KSGGKSKAIEYDNFIE 378 K+GGKSKAIEYDNFIE Sbjct: 246 KTGGKSKAIEYDNFIE 261 >dbj|GAV89367.1| EF_hand_4 domain-containing protein [Cephalotus follicularis] Length = 297 Score = 68.2 bits (165), Expect(2) = 2e-13 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -2 Query: 378 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 277 GLTEKFKEKDT+YSGSATFTYE+FMLTVLPFLIA Sbjct: 264 GLTEKFKEKDTTYSGSATFTYEAFMLTVLPFLIA 297 Score = 35.0 bits (79), Expect(2) = 2e-13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 425 KSGGKSKAIEYDNFIE 378 KSGGK+KAIEYDNFIE Sbjct: 242 KSGGKNKAIEYDNFIE 257 >gb|AQK57284.1| putative calcium-binding protein CML50 [Zea mays] Length = 296 Score = 68.2 bits (165), Expect(2) = 2e-13 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -2 Query: 378 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 277 GLTEKFKEKDT+YSGSATFTYE+FMLTVLPFLIA Sbjct: 263 GLTEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 296 Score = 35.0 bits (79), Expect(2) = 2e-13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 425 KSGGKSKAIEYDNFIE 378 K+GGKSKAIEYDNFIE Sbjct: 241 KTGGKSKAIEYDNFIE 256 >ref|XP_003535891.2| PREDICTED: probable calcium-binding protein CML49 [Glycine max] gb|KRH33201.1| hypothetical protein GLYMA_10G106400 [Glycine max] Length = 284 Score = 68.2 bits (165), Expect(2) = 2e-13 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -2 Query: 378 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 277 GLT+KFKEKDT+YSGSATFTYESFMLTVLPFLIA Sbjct: 251 GLTDKFKEKDTAYSGSATFTYESFMLTVLPFLIA 284 Score = 35.0 bits (79), Expect(2) = 2e-13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 425 KSGGKSKAIEYDNFIE 378 K+GGKSKAIEYDNFIE Sbjct: 229 KTGGKSKAIEYDNFIE 244 >ref|XP_021317104.1| probable calcium-binding protein CML49 isoform X2 [Sorghum bicolor] Length = 250 Score = 68.2 bits (165), Expect(2) = 2e-13 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -2 Query: 378 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 277 GLTEKFKEKDT+YSGSATFTYE+FMLTVLPFLIA Sbjct: 217 GLTEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 250 Score = 35.0 bits (79), Expect(2) = 2e-13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 425 KSGGKSKAIEYDNFIE 378 K+GGKSKAIEYDNFIE Sbjct: 195 KTGGKSKAIEYDNFIE 210 >gb|ACN31166.1| unknown [Zea mays] Length = 153 Score = 68.2 bits (165), Expect(2) = 2e-13 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -2 Query: 378 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 277 GLTEKFKEKDT+YSGSATFTYE+FMLTVLPFLIA Sbjct: 120 GLTEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 153 Score = 35.0 bits (79), Expect(2) = 2e-13 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 425 KSGGKSKAIEYDNFIE 378 K+GGKSKAIEYDNFIE Sbjct: 98 KTGGKSKAIEYDNFIE 113 >emb|CDY41394.1| BnaCnng10300D [Brassica napus] Length = 404 Score = 68.9 bits (167), Expect(2) = 2e-13 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 378 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 277 GLTEKFKEKDT YSGSATFTYESFMLTVLPFLIA Sbjct: 371 GLTEKFKEKDTGYSGSATFTYESFMLTVLPFLIA 404 Score = 33.9 bits (76), Expect(2) = 2e-13 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = -3 Query: 425 KSGGKSKAIEYDNFIE 378 KSGGK++AIEYDNFIE Sbjct: 349 KSGGKNRAIEYDNFIE 364 >ref|XP_013724647.1| probable calcium-binding protein CML50 isoform X1 [Brassica napus] Length = 387 Score = 68.9 bits (167), Expect(2) = 2e-13 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 378 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 277 GLTEKFKEKDT YSGSATFTYESFMLTVLPFLIA Sbjct: 354 GLTEKFKEKDTGYSGSATFTYESFMLTVLPFLIA 387 Score = 33.9 bits (76), Expect(2) = 2e-13 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = -3 Query: 425 KSGGKSKAIEYDNFIE 378 KSGGK++AIEYDNFIE Sbjct: 332 KSGGKNRAIEYDNFIE 347