BLASTX nr result
ID: Ophiopogon22_contig00016948
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00016948 (475 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020248902.1| phosphatidylinositol N-acetylglucosaminyltra... 57 3e-07 ref|XP_020248903.1| phosphatidylinositol N-acetylglucosaminyltra... 56 6e-07 >ref|XP_020248902.1| phosphatidylinositol N-acetylglucosaminyltransferase subunit P-like isoform X1 [Asparagus officinalis] gb|ONK56014.1| uncharacterized protein A4U43_C10F3250 [Asparagus officinalis] Length = 178 Score = 57.4 bits (137), Expect = 3e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 3 AMVTVFLGMVFYLGLNFMVAPLPTSYYTMFGQY 101 AMV+V LGMVFYLGLNFMV P PTSYYTMF ++ Sbjct: 108 AMVSVVLGMVFYLGLNFMVTPPPTSYYTMFDEH 140 >ref|XP_020248903.1| phosphatidylinositol N-acetylglucosaminyltransferase subunit P-like isoform X2 [Asparagus officinalis] Length = 149 Score = 56.2 bits (134), Expect = 6e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +3 Query: 3 AMVTVFLGMVFYLGLNFMVAPLPTSYYTMF 92 AMV+V LGMVFYLGLNFMV P PTSYYTMF Sbjct: 108 AMVSVVLGMVFYLGLNFMVTPPPTSYYTMF 137