BLASTX nr result
ID: Ophiopogon22_contig00016826
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00016826 (393 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKU80297.1| hypothetical protein MA16_Dca005828 [Dendrobium c... 57 5e-08 >gb|PKU80297.1| hypothetical protein MA16_Dca005828 [Dendrobium catenatum] Length = 79 Score = 56.6 bits (135), Expect = 5e-08 Identities = 31/67 (46%), Positives = 40/67 (59%), Gaps = 2/67 (2%) Frame = -2 Query: 323 AYIFLLILAISCLHHQY--CSARPLVDAWWPEEAGSLLLESLPRGPHGSSTGSTCTHNPN 150 A I L++L +S ++ Q+ +ARP+V W E SL LESLP+GP S S CT NP Sbjct: 11 ARILLMVLLVSNIYAQFPAMAARPIVPRDWWSEDWSLFLESLPKGPTTPSEASGCTSNPV 70 Query: 149 IRGGRCP 129 GG CP Sbjct: 71 NNGGICP 77