BLASTX nr result
ID: Ophiopogon22_contig00016755
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00016755 (408 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020271516.1| chitinase domain-containing protein 1 [Aspar... 99 2e-21 ref|XP_009393083.1| PREDICTED: chitinase domain-containing prote... 92 3e-19 ref|XP_010913890.1| PREDICTED: chitinase domain-containing prote... 84 2e-16 ref|XP_020098470.1| chitinase domain-containing protein 1 [Anana... 84 3e-16 ref|XP_008810828.1| PREDICTED: chitinase domain-containing prote... 81 5e-16 ref|XP_004969189.1| chitinase domain-containing protein 1 [Setar... 82 1e-15 ref|XP_010266473.1| PREDICTED: chitinase domain-containing prote... 81 3e-15 ref|XP_008810827.1| PREDICTED: chitinase domain-containing prote... 81 3e-15 ref|XP_020165154.1| chitinase domain-containing protein 1-like [... 80 7e-15 gb|OVA01938.1| Glycoside hydrolase [Macleaya cordata] 80 1e-14 ref|XP_021313412.1| chitinase domain-containing protein 1 isofor... 79 1e-14 ref|XP_020672821.1| chitinase domain-containing protein 1 [Dendr... 79 1e-14 ref|XP_002455966.2| chitinase domain-containing protein 1 isofor... 79 1e-14 ref|XP_023754495.1| chitinase domain-containing protein 1 [Lactu... 79 2e-14 emb|CDM83429.1| unnamed protein product [Triticum aestivum] 79 3e-14 gb|KQK08766.1| hypothetical protein BRADI_2g43770v3 [Brachypodiu... 78 4e-14 ref|XP_003569377.1| PREDICTED: chitinase domain-containing prote... 78 5e-14 gb|KVH91091.1| Chitinase II [Cynara cardunculus var. scolymus] 78 6e-14 gb|POF11707.1| isoform 2 of chitinase domain-containing protein ... 77 6e-14 ref|XP_023911384.1| chitinase domain-containing protein 1 [Querc... 77 6e-14 >ref|XP_020271516.1| chitinase domain-containing protein 1 [Asparagus officinalis] Length = 427 Score = 98.6 bits (244), Expect = 2e-21 Identities = 51/99 (51%), Positives = 64/99 (64%), Gaps = 3/99 (3%) Frame = +2 Query: 119 SDHPVDEPRTARSNFNHLHLYXXXXXXXXXFFLGSAYRFY---RTSLVQSVYDRGLVKPN 289 SD V +PR SN L Y LG++ Y +S + SV+DR LVKP Sbjct: 17 SDRAVRDPRIPASNGRSLSSYLIFIVFVL-LVLGASIALYPSSHSSPILSVFDRELVKPR 75 Query: 290 VEYQEIIRESTRVSRNRTHRHFPNPVLAYITPWNSKGYE 406 V+Y+EIIRE+ +V+ NRTHRHFPNPVLAY+TPWNSKGY+ Sbjct: 76 VDYKEIIRENAKVAENRTHRHFPNPVLAYVTPWNSKGYD 114 >ref|XP_009393083.1| PREDICTED: chitinase domain-containing protein 1 [Musa acuminata subsp. malaccensis] Length = 434 Score = 92.4 bits (228), Expect = 3e-19 Identities = 41/55 (74%), Positives = 48/55 (87%) Frame = +2 Query: 242 TSLVQSVYDRGLVKPNVEYQEIIRESTRVSRNRTHRHFPNPVLAYITPWNSKGYE 406 TSL SVY+RGLVKPNV +QEI+ E++R S NR+ RHFPNPVLAYITPWNS+GYE Sbjct: 69 TSLALSVYERGLVKPNVAFQEILAENSRFSENRSRRHFPNPVLAYITPWNSRGYE 123 >ref|XP_010913890.1| PREDICTED: chitinase domain-containing protein 1 [Elaeis guineensis] Length = 439 Score = 84.3 bits (207), Expect = 2e-16 Identities = 54/113 (47%), Positives = 65/113 (57%), Gaps = 12/113 (10%) Frame = +2 Query: 104 DRPVQSDHPVDEP--RTARSNFNHLHLYXXXXXXXXXFFL--GS--AYRFYR------TS 247 DRP SDHP + R+ ++ FFL GS YR R TS Sbjct: 15 DRPSGSDHPGRDSWTRSRAASTPRFPSSASLLVFSLAFFLVVGSLTVYRGSRRRPVAATS 74 Query: 248 LVQSVYDRGLVKPNVEYQEIIRESTRVSRNRTHRHFPNPVLAYITPWNSKGYE 406 SVY+RGLVK +V +QEI+ E RVS N++ RHFPNPVLAYITPWNS+GYE Sbjct: 75 PALSVYERGLVKRDVSFQEILTEHGRVSENKSGRHFPNPVLAYITPWNSRGYE 127 >ref|XP_020098470.1| chitinase domain-containing protein 1 [Ananas comosus] gb|OAY85599.1| Chitinase domain-containing protein 1 [Ananas comosus] Length = 429 Score = 84.0 bits (206), Expect = 3e-16 Identities = 36/50 (72%), Positives = 44/50 (88%) Frame = +2 Query: 257 SVYDRGLVKPNVEYQEIIRESTRVSRNRTHRHFPNPVLAYITPWNSKGYE 406 SVY+RGLVK +V ++EI+ E+ RVS NR+ RHFPNPVLAY+TPWNSKGYE Sbjct: 73 SVYERGLVKADVAFREILAENARVSENRSRRHFPNPVLAYVTPWNSKGYE 122 >ref|XP_008810828.1| PREDICTED: chitinase domain-containing protein 1 isoform X2 [Phoenix dactylifera] Length = 239 Score = 81.3 bits (199), Expect = 5e-16 Identities = 36/50 (72%), Positives = 43/50 (86%) Frame = +2 Query: 257 SVYDRGLVKPNVEYQEIIRESTRVSRNRTHRHFPNPVLAYITPWNSKGYE 406 SVY+RGLVK +V +QEI+ E RVS N++ RHFPNPVLAYITPWNS+GYE Sbjct: 78 SVYERGLVKRDVSFQEILTEHGRVSENKSGRHFPNPVLAYITPWNSRGYE 127 >ref|XP_004969189.1| chitinase domain-containing protein 1 [Setaria italica] Length = 428 Score = 82.0 bits (201), Expect = 1e-15 Identities = 36/50 (72%), Positives = 43/50 (86%) Frame = +2 Query: 257 SVYDRGLVKPNVEYQEIIRESTRVSRNRTHRHFPNPVLAYITPWNSKGYE 406 SVY+RGLVK +V +EI+ E TRVS NR+ RHFPNPVLAY+TPWNSKGY+ Sbjct: 70 SVYERGLVKRDVSAREILTEHTRVSENRSQRHFPNPVLAYVTPWNSKGYD 119 >ref|XP_010266473.1| PREDICTED: chitinase domain-containing protein 1 [Nelumbo nucifera] Length = 434 Score = 81.3 bits (199), Expect = 3e-15 Identities = 36/55 (65%), Positives = 45/55 (81%) Frame = +2 Query: 242 TSLVQSVYDRGLVKPNVEYQEIIRESTRVSRNRTHRHFPNPVLAYITPWNSKGYE 406 T+ + SVYDRGLV+ NV YQEI+ E+ +VS N ++RHF PVLAY+TPWNSKGYE Sbjct: 67 TNELLSVYDRGLVRTNVNYQEILAENLKVSENTSYRHFKYPVLAYVTPWNSKGYE 121 >ref|XP_008810827.1| PREDICTED: chitinase domain-containing protein 1 isoform X1 [Phoenix dactylifera] Length = 439 Score = 81.3 bits (199), Expect = 3e-15 Identities = 36/50 (72%), Positives = 43/50 (86%) Frame = +2 Query: 257 SVYDRGLVKPNVEYQEIIRESTRVSRNRTHRHFPNPVLAYITPWNSKGYE 406 SVY+RGLVK +V +QEI+ E RVS N++ RHFPNPVLAYITPWNS+GYE Sbjct: 78 SVYERGLVKRDVSFQEILTEHGRVSENKSGRHFPNPVLAYITPWNSRGYE 127 >ref|XP_020165154.1| chitinase domain-containing protein 1-like [Aegilops tauschii subsp. tauschii] Length = 432 Score = 80.1 bits (196), Expect = 7e-15 Identities = 36/50 (72%), Positives = 40/50 (80%) Frame = +2 Query: 257 SVYDRGLVKPNVEYQEIIRESTRVSRNRTHRHFPNPVLAYITPWNSKGYE 406 SVYDRGLVK V EI+ E RVS NR+ RHFPNPVLAY+TPWNSKGY+ Sbjct: 72 SVYDRGLVKRQVSAGEILAEHARVSENRSRRHFPNPVLAYVTPWNSKGYD 121 >gb|OVA01938.1| Glycoside hydrolase [Macleaya cordata] Length = 440 Score = 79.7 bits (195), Expect = 1e-14 Identities = 33/52 (63%), Positives = 43/52 (82%) Frame = +2 Query: 251 VQSVYDRGLVKPNVEYQEIIRESTRVSRNRTHRHFPNPVLAYITPWNSKGYE 406 + SVY+RGLVKPN YQEI+ E++RVS N + RH+ P+LAYITPWNS+GY+ Sbjct: 76 LSSVYERGLVKPNANYQEILAENSRVSENTSRRHYTYPILAYITPWNSRGYD 127 >ref|XP_021313412.1| chitinase domain-containing protein 1 isoform X2 [Sorghum bicolor] Length = 432 Score = 79.3 bits (194), Expect = 1e-14 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = +2 Query: 257 SVYDRGLVKPNVEYQEIIRESTRVSRNRTHRHFPNPVLAYITPWNSKGYE 406 SVY+RGLVK +V +EI+ E TRVS NR+ R+FPNPVLAY+TPWNSKGY+ Sbjct: 116 SVYERGLVKRDVSAREILAEHTRVSENRSQRNFPNPVLAYVTPWNSKGYD 165 >ref|XP_020672821.1| chitinase domain-containing protein 1 [Dendrobium catenatum] Length = 436 Score = 79.3 bits (194), Expect = 1e-14 Identities = 46/110 (41%), Positives = 62/110 (56%), Gaps = 9/110 (8%) Frame = +2 Query: 104 DRPVQSDHPVDEPRTAR-SNFNHLHLYXXXXXXXXXFFLGSAYRFY--------RTSLVQ 256 +R + SD P++ +T L + F L S++ Y S Sbjct: 15 NRRMVSDEPIEGNQTDEFDGHRRLPISPFTIFFVVLFLLASSFAVYWGSRSTRKAPSHQL 74 Query: 257 SVYDRGLVKPNVEYQEIIRESTRVSRNRTHRHFPNPVLAYITPWNSKGYE 406 SVY+RG+VK +V Y+EI+ E+ RV NR+ RHFPNPVLAYITPWNS+GYE Sbjct: 75 SVYERGIVKTDVCYKEILIENARVMFNRSVRHFPNPVLAYITPWNSRGYE 124 >ref|XP_002455966.2| chitinase domain-containing protein 1 isoform X1 [Sorghum bicolor] gb|KXG32913.2| hypothetical protein SORBI_3003G223300 [Sorghum bicolor] Length = 476 Score = 79.3 bits (194), Expect = 1e-14 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = +2 Query: 257 SVYDRGLVKPNVEYQEIIRESTRVSRNRTHRHFPNPVLAYITPWNSKGYE 406 SVY+RGLVK +V +EI+ E TRVS NR+ R+FPNPVLAY+TPWNSKGY+ Sbjct: 116 SVYERGLVKRDVSAREILAEHTRVSENRSQRNFPNPVLAYVTPWNSKGYD 165 >ref|XP_023754495.1| chitinase domain-containing protein 1 [Lactuca sativa] gb|PLY92535.1| hypothetical protein LSAT_3X139600 [Lactuca sativa] Length = 430 Score = 79.0 bits (193), Expect = 2e-14 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +2 Query: 260 VYDRGLVKPNVEYQEIIRESTRVSRNRTHRHFPNPVLAYITPWNSKGYE 406 VY RGLVK ++ YQEI+ E+ +VS N + RHFPNPVLAY+TPWNSKGY+ Sbjct: 76 VYQRGLVKTDINYQEILTENAKVSENTSIRHFPNPVLAYVTPWNSKGYD 124 >emb|CDM83429.1| unnamed protein product [Triticum aestivum] Length = 432 Score = 78.6 bits (192), Expect = 3e-14 Identities = 35/50 (70%), Positives = 40/50 (80%) Frame = +2 Query: 257 SVYDRGLVKPNVEYQEIIRESTRVSRNRTHRHFPNPVLAYITPWNSKGYE 406 SVYDRGLVK V EI+ E RVS N++ RHFPNPVLAY+TPWNSKGY+ Sbjct: 72 SVYDRGLVKRQVSAGEILAEHARVSENQSRRHFPNPVLAYVTPWNSKGYD 121 >gb|KQK08766.1| hypothetical protein BRADI_2g43770v3 [Brachypodium distachyon] Length = 395 Score = 77.8 bits (190), Expect = 4e-14 Identities = 33/50 (66%), Positives = 41/50 (82%) Frame = +2 Query: 257 SVYDRGLVKPNVEYQEIIRESTRVSRNRTHRHFPNPVLAYITPWNSKGYE 406 S+Y+RGLVK + +EI+ E RVS NR+ RHFPNPVLAY+TPWNSKGY+ Sbjct: 74 SIYERGLVKLEISSREILAEHGRVSENRSRRHFPNPVLAYVTPWNSKGYD 123 >ref|XP_003569377.1| PREDICTED: chitinase domain-containing protein 1 [Brachypodium distachyon] gb|KQK08764.1| hypothetical protein BRADI_2g43770v3 [Brachypodium distachyon] Length = 429 Score = 77.8 bits (190), Expect = 5e-14 Identities = 33/50 (66%), Positives = 41/50 (82%) Frame = +2 Query: 257 SVYDRGLVKPNVEYQEIIRESTRVSRNRTHRHFPNPVLAYITPWNSKGYE 406 S+Y+RGLVK + +EI+ E RVS NR+ RHFPNPVLAY+TPWNSKGY+ Sbjct: 74 SIYERGLVKLEISSREILAEHGRVSENRSRRHFPNPVLAYVTPWNSKGYD 123 >gb|KVH91091.1| Chitinase II [Cynara cardunculus var. scolymus] Length = 846 Score = 77.8 bits (190), Expect = 6e-14 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +2 Query: 260 VYDRGLVKPNVEYQEIIRESTRVSRNRTHRHFPNPVLAYITPWNSKGYE 406 VY RGLVK +V YQEI+ E+ +VS N ++RHFP PVLAY+TPWNS+GYE Sbjct: 73 VYQRGLVKTDVNYQEILAENAKVSENASNRHFPYPVLAYVTPWNSRGYE 121 >gb|POF11707.1| isoform 2 of chitinase domain-containing protein 1 [Quercus suber] Length = 404 Score = 77.4 bits (189), Expect = 6e-14 Identities = 33/49 (67%), Positives = 42/49 (85%) Frame = +2 Query: 260 VYDRGLVKPNVEYQEIIRESTRVSRNRTHRHFPNPVLAYITPWNSKGYE 406 V+ RGLVK NV++QEI+ E+++VS N +HRH+ PVLAYITPWNSKGYE Sbjct: 67 VFQRGLVKANVDFQEILAENSKVSENTSHRHYNYPVLAYITPWNSKGYE 115 >ref|XP_023911384.1| chitinase domain-containing protein 1 [Quercus suber] Length = 428 Score = 77.4 bits (189), Expect = 6e-14 Identities = 33/49 (67%), Positives = 42/49 (85%) Frame = +2 Query: 260 VYDRGLVKPNVEYQEIIRESTRVSRNRTHRHFPNPVLAYITPWNSKGYE 406 V+ RGLVK NV++QEI+ E+++VS N +HRH+ PVLAYITPWNSKGYE Sbjct: 67 VFQRGLVKANVDFQEILAENSKVSENTSHRHYNYPVLAYITPWNSKGYE 115