BLASTX nr result
ID: Ophiopogon22_contig00016638
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00016638 (1364 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020271053.1| protein PIN-LIKES 3-like isoform X1 [Asparag... 43 2e-07 ref|XP_020271078.1| protein PIN-LIKES 4-like isoform X2 [Asparag... 43 2e-07 >ref|XP_020271053.1| protein PIN-LIKES 3-like isoform X1 [Asparagus officinalis] ref|XP_020271060.1| protein PIN-LIKES 3-like isoform X1 [Asparagus officinalis] ref|XP_020271066.1| protein PIN-LIKES 3-like isoform X1 [Asparagus officinalis] ref|XP_020271072.1| protein PIN-LIKES 3-like isoform X1 [Asparagus officinalis] Length = 418 Score = 42.7 bits (99), Expect(2) = 2e-07 Identities = 17/28 (60%), Positives = 23/28 (82%) Frame = +3 Query: 1083 NPLYHFILLLQYVAPPAMNISTFCLLYK 1166 +PLYHFILLLQY PPAMNI++ +++ Sbjct: 358 DPLYHFILLLQYAVPPAMNITSMVQMFE 385 Score = 42.4 bits (98), Expect(2) = 2e-07 Identities = 25/58 (43%), Positives = 31/58 (53%), Gaps = 5/58 (8%) Frame = +2 Query: 923 IPSFHLTTGGNLTSGDDISPLFLELYLSDTV-----LTLVGIFIVRHAAHLVVVQLDP 1081 IP HL TGGNLT G + + L + L L+GIFIV+ A HL +V DP Sbjct: 302 IPCIHLITGGNLTKGLQGPTIKFSIILGVMIVRYIALPLIGIFIVQWAVHLGLVHSDP 359 >ref|XP_020271078.1| protein PIN-LIKES 4-like isoform X2 [Asparagus officinalis] Length = 339 Score = 42.7 bits (99), Expect(2) = 2e-07 Identities = 17/28 (60%), Positives = 23/28 (82%) Frame = +3 Query: 1083 NPLYHFILLLQYVAPPAMNISTFCLLYK 1166 +PLYHFILLLQY PPAMNI++ +++ Sbjct: 279 DPLYHFILLLQYAVPPAMNITSMVQMFE 306 Score = 42.4 bits (98), Expect(2) = 2e-07 Identities = 25/58 (43%), Positives = 31/58 (53%), Gaps = 5/58 (8%) Frame = +2 Query: 923 IPSFHLTTGGNLTSGDDISPLFLELYLSDTV-----LTLVGIFIVRHAAHLVVVQLDP 1081 IP HL TGGNLT G + + L + L L+GIFIV+ A HL +V DP Sbjct: 223 IPCIHLITGGNLTKGLQGPTIKFSIILGVMIVRYIALPLIGIFIVQWAVHLGLVHSDP 280