BLASTX nr result
ID: Ophiopogon22_contig00016597
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00016597 (470 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020240861.1| scarecrow-like protein 6 [Asparagus officina... 59 5e-07 >ref|XP_020240861.1| scarecrow-like protein 6 [Asparagus officinalis] Length = 600 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/44 (68%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = +2 Query: 341 MPCTQFQSQGVLQADETANFWSNKKRKGVSSI-EPTSVLDKRRS 469 MP TQ QSQGV + + A+FWSNKKRK V+ + EPTSVLDKRRS Sbjct: 1 MPFTQIQSQGVEEHEIRADFWSNKKRKAVAGLREPTSVLDKRRS 44