BLASTX nr result
ID: Ophiopogon22_contig00015469
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00015469 (428 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001306847.1| peroxisomal membrane protein 13-like [Elaeis... 61 3e-08 ref|XP_020274951.1| peroxisomal membrane protein 13 [Asparagus o... 61 4e-08 >ref|NP_001306847.1| peroxisomal membrane protein 13-like [Elaeis guineensis] gb|AGE46029.1| putative peroxisome biogenesis factor 13 [Elaeis guineensis] Length = 284 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -1 Query: 428 GELTGPDGQGQHYIEGPKAPTGAWDNVWGAEGANAA 321 G L GPDG GQHYIEGPKA TG+WDNVWG + A+ Sbjct: 249 GRLPGPDGNGQHYIEGPKAATGSWDNVWGNDVKEAS 284 >ref|XP_020274951.1| peroxisomal membrane protein 13 [Asparagus officinalis] gb|ONK65158.1| uncharacterized protein A4U43_C07F34290 [Asparagus officinalis] Length = 290 Score = 60.8 bits (146), Expect = 4e-08 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 428 GELTGPDGQGQHYIEGPKAPTGAWDNVWG 342 GEL GPDGQ Q YIEGPKAP+G+WDNVWG Sbjct: 258 GELPGPDGQAQQYIEGPKAPSGSWDNVWG 286