BLASTX nr result
ID: Ophiopogon22_contig00015462
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00015462 (720 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020258741.1| uncharacterized protein LOC109835163 [Aspara... 64 6e-08 >ref|XP_020258741.1| uncharacterized protein LOC109835163 [Asparagus officinalis] Length = 440 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = -3 Query: 718 MLTYCRTENQIADIFTKPLKTETFLKLKRQLGLISNE 608 ML+YC++E+QIADIFTKPLKTETFLKLK++LGL NE Sbjct: 402 MLSYCKSEDQIADIFTKPLKTETFLKLKKKLGLERNE 438