BLASTX nr result
ID: Ophiopogon22_contig00015293
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00015293 (459 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244519.1| uncharacterized protein LOC109822701 [Aspara... 62 3e-09 gb|OEL25269.1| hypothetical protein BAE44_0013714 [Dichanthelium... 60 1e-08 ref|XP_003562723.1| PREDICTED: uncharacterized protein LOC100835... 60 2e-08 ref|XP_010936430.1| PREDICTED: uncharacterized protein LOC105056... 57 3e-07 ref|XP_002460991.1| uncharacterized protein LOC8081537 [Sorghum ... 57 4e-07 gb|ACG40034.1| hypothetical protein [Zea mays] 54 1e-06 gb|OQU90224.1| hypothetical protein SORBI_3002G368901 [Sorghum b... 57 2e-06 ref|XP_008670555.1| uncharacterized protein LOC100277291 [Zea ma... 55 2e-06 ref|XP_009388732.1| PREDICTED: uncharacterized protein LOC103975... 54 3e-06 ref|XP_004958249.1| uncharacterized protein LOC101777108 [Setari... 54 6e-06 >ref|XP_020244519.1| uncharacterized protein LOC109822701 [Asparagus officinalis] Length = 148 Score = 62.0 bits (149), Expect = 3e-09 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -2 Query: 293 LMRAPGRGGAMMPRGVFEGNPRGYFRDLQAKKDLPNHW 180 +M+APGR GA+MPR +FEGNPR YF DL+AKK LPN++ Sbjct: 109 MMKAPGRNGALMPRDLFEGNPREYFIDLRAKKQLPNYY 146 >gb|OEL25269.1| hypothetical protein BAE44_0013714 [Dichanthelium oligosanthes] Length = 155 Score = 60.5 bits (145), Expect = 1e-08 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -2 Query: 293 LMRAPGRGGAMMPRGVFEGNPRGYFRDLQAKKDL 192 +M APGRGGA MPRGVFEGNPRGYF DL+A+K L Sbjct: 120 MMVAPGRGGARMPRGVFEGNPRGYFLDLRARKPL 153 >ref|XP_003562723.1| PREDICTED: uncharacterized protein LOC100835813 [Brachypodium distachyon] Length = 158 Score = 60.1 bits (144), Expect = 2e-08 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -2 Query: 290 MRAPGRGGAMMPRGVFEGNPRGYFRDLQAKKDL 192 M APGRGGA MPRG FEGNPRGYFRDL+A K L Sbjct: 124 MVAPGRGGARMPRGAFEGNPRGYFRDLRANKPL 156 >ref|XP_010936430.1| PREDICTED: uncharacterized protein LOC105056064 [Elaeis guineensis] Length = 141 Score = 56.6 bits (135), Expect = 3e-07 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -2 Query: 293 LMRAPGRGGAMMPRGVFEGNPRGYFRDLQAKKDL 192 +M+APGRGG +MPR FEGNP+ YFRDL A KDL Sbjct: 106 MMKAPGRGGRLMPRASFEGNPQSYFRDLHAGKDL 139 >ref|XP_002460991.1| uncharacterized protein LOC8081537 [Sorghum bicolor] Length = 157 Score = 56.6 bits (135), Expect = 4e-07 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = -2 Query: 290 MRAPGRGGAMMPRGVFEGNPRGYFRDLQAKKDL 192 M APGRGGA MPRGVFE NPR YFRDL+A K L Sbjct: 123 MAAPGRGGARMPRGVFENNPRDYFRDLRAGKPL 155 >gb|ACG40034.1| hypothetical protein [Zea mays] Length = 73 Score = 53.5 bits (127), Expect = 1e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -2 Query: 290 MRAPGRGGAMMPRGVFEGNPRGYFRDLQAKKDL 192 M APGRGGA MPRG FE NPR YFRDL A K L Sbjct: 39 MAAPGRGGARMPRGAFENNPRLYFRDLHAGKPL 71 >gb|OQU90224.1| hypothetical protein SORBI_3002G368901 [Sorghum bicolor] Length = 276 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = -2 Query: 290 MRAPGRGGAMMPRGVFEGNPRGYFRDLQAKKDL 192 M APGRGGA MPRGVFE NPR YFRDL+A K L Sbjct: 123 MAAPGRGGARMPRGVFENNPRDYFRDLRAGKPL 155 >ref|XP_008670555.1| uncharacterized protein LOC100277291 [Zea mays] gb|ONM25171.1| hypothetical protein ZEAMMB73_Zm00001d006815 [Zea mays] Length = 156 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = -2 Query: 299 ALLMRAPGRGGAMMPRGVFEGNPRGYFRDLQAKKDL 192 A M APGRGGA MPRG FE NPR YFRDL+A K L Sbjct: 119 ARFMAAPGRGGARMPRGAFENNPRLYFRDLRAGKPL 154 >ref|XP_009388732.1| PREDICTED: uncharacterized protein LOC103975481 [Musa acuminata subsp. malaccensis] Length = 142 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -2 Query: 293 LMRAPGRGGAMMPRGVFEGNPRGYFRDLQAKKDL 192 +MRAPGR GA+MPR FE +PRGYF +L+AKKDL Sbjct: 107 MMRAPGRHGAVMPRASFESDPRGYFINLRAKKDL 140 >ref|XP_004958249.1| uncharacterized protein LOC101777108 [Setaria italica] gb|KQL26590.1| hypothetical protein SETIT_032288mg [Setaria italica] Length = 157 Score = 53.5 bits (127), Expect = 6e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 293 LMRAPGRGGAMMPRGVFEGNPRGYFRDLQAKKDL 192 LM APGRGGA MPR VFE +PR YFRDL+A+K L Sbjct: 122 LMVAPGRGGARMPRDVFEDDPRRYFRDLRARKPL 155