BLASTX nr result
ID: Ophiopogon22_contig00015143
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00015143 (351 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020257867.1| lariat debranching enzyme isoform X3 [Aspara... 68 6e-11 ref|XP_020257866.1| lariat debranching enzyme isoform X2 [Aspara... 68 6e-11 ref|XP_020257865.1| lariat debranching enzyme isoform X1 [Aspara... 68 6e-11 gb|PKU83454.1| Lariat debranching enzyme [Dendrobium catenatum] 66 3e-10 ref|XP_020702334.1| lariat debranching enzyme-like isoform X2 [D... 66 3e-10 ref|XP_020702333.1| lariat debranching enzyme-like isoform X1 [D... 66 3e-10 ref|XP_020591193.1| lariat debranching enzyme [Phalaenopsis eque... 65 8e-10 gb|PKA48434.1| Lariat debranching enzyme [Apostasia shenzhenica] 64 1e-09 ref|XP_017698422.1| PREDICTED: lariat debranching enzyme-like [P... 63 3e-09 ref|XP_020161992.1| lariat debranching enzyme [Aegilops tauschii... 63 5e-09 ref|XP_021900134.1| lariat debranching enzyme isoform X4 [Carica... 62 6e-09 ref|XP_021900133.1| lariat debranching enzyme isoform X3 [Carica... 62 7e-09 ref|XP_018839550.1| PREDICTED: lariat debranching enzyme isoform... 62 7e-09 ref|XP_021900132.1| lariat debranching enzyme isoform X2 [Carica... 62 7e-09 ref|XP_021900130.1| lariat debranching enzyme isoform X1 [Carica... 62 7e-09 ref|XP_018839549.1| PREDICTED: lariat debranching enzyme isoform... 62 7e-09 ref|XP_018839548.1| PREDICTED: lariat debranching enzyme isoform... 62 7e-09 ref|XP_018839547.1| PREDICTED: lariat debranching enzyme isoform... 62 7e-09 gb|OAY82687.1| Lariat debranching enzyme [Ananas comosus] 62 1e-08 ref|XP_020101377.1| lariat debranching enzyme isoform X1 [Ananas... 61 2e-08 >ref|XP_020257867.1| lariat debranching enzyme isoform X3 [Asparagus officinalis] gb|ONK76079.1| uncharacterized protein A4U43_C03F23660 [Asparagus officinalis] Length = 415 Score = 68.2 bits (165), Expect = 6e-11 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -1 Query: 351 PVAIFMSHDWPLGVTEYGDWEKLVQRKPHFKEE 253 P+ IFMSHDWPLG+TEYG+WEKL++ KPHFKEE Sbjct: 167 PIDIFMSHDWPLGITEYGNWEKLIRSKPHFKEE 199 >ref|XP_020257866.1| lariat debranching enzyme isoform X2 [Asparagus officinalis] Length = 422 Score = 68.2 bits (165), Expect = 6e-11 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -1 Query: 351 PVAIFMSHDWPLGVTEYGDWEKLVQRKPHFKEE 253 P+ IFMSHDWPLG+TEYG+WEKL++ KPHFKEE Sbjct: 167 PIDIFMSHDWPLGITEYGNWEKLIRSKPHFKEE 199 >ref|XP_020257865.1| lariat debranching enzyme isoform X1 [Asparagus officinalis] Length = 423 Score = 68.2 bits (165), Expect = 6e-11 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -1 Query: 351 PVAIFMSHDWPLGVTEYGDWEKLVQRKPHFKEE 253 P+ IFMSHDWPLG+TEYG+WEKL++ KPHFKEE Sbjct: 167 PIDIFMSHDWPLGITEYGNWEKLIRSKPHFKEE 199 >gb|PKU83454.1| Lariat debranching enzyme [Dendrobium catenatum] Length = 421 Score = 66.2 bits (160), Expect = 3e-10 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = -1 Query: 351 PVAIFMSHDWPLGVTEYGDWEKLVQRKPHFKEE 253 P+ IF+SHDWPLG+T+YG+WEKLVQ+KP+FKEE Sbjct: 167 PIDIFLSHDWPLGITDYGNWEKLVQQKPYFKEE 199 >ref|XP_020702334.1| lariat debranching enzyme-like isoform X2 [Dendrobium catenatum] ref|XP_020702335.1| lariat debranching enzyme-like isoform X2 [Dendrobium catenatum] Length = 421 Score = 66.2 bits (160), Expect = 3e-10 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = -1 Query: 351 PVAIFMSHDWPLGVTEYGDWEKLVQRKPHFKEE 253 P+ IF+SHDWPLG+T+YG+WEKLVQ+KP+FKEE Sbjct: 167 PIDIFLSHDWPLGITDYGNWEKLVQQKPYFKEE 199 >ref|XP_020702333.1| lariat debranching enzyme-like isoform X1 [Dendrobium catenatum] Length = 427 Score = 66.2 bits (160), Expect = 3e-10 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = -1 Query: 351 PVAIFMSHDWPLGVTEYGDWEKLVQRKPHFKEE 253 P+ IF+SHDWPLG+T+YG+WEKLVQ+KP+FKEE Sbjct: 167 PIDIFLSHDWPLGITDYGNWEKLVQQKPYFKEE 199 >ref|XP_020591193.1| lariat debranching enzyme [Phalaenopsis equestris] Length = 421 Score = 65.1 bits (157), Expect = 8e-10 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -1 Query: 351 PVAIFMSHDWPLGVTEYGDWEKLVQRKPHFKEE 253 P+ IF+SHDWPLG+TEYG+WEKLVQ+KP FK+E Sbjct: 167 PIDIFLSHDWPLGITEYGNWEKLVQQKPFFKDE 199 >gb|PKA48434.1| Lariat debranching enzyme [Apostasia shenzhenica] Length = 421 Score = 64.3 bits (155), Expect = 1e-09 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = -1 Query: 351 PVAIFMSHDWPLGVTEYGDWEKLVQRKPHFKEE 253 P+ IF+SHDWPLG+TE+G+WEKL+Q+KP FKEE Sbjct: 167 PIDIFLSHDWPLGITEFGNWEKLIQQKPFFKEE 199 >ref|XP_017698422.1| PREDICTED: lariat debranching enzyme-like [Phoenix dactylifera] Length = 312 Score = 63.2 bits (152), Expect = 3e-09 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -1 Query: 348 VAIFMSHDWPLGVTEYGDWEKLVQRKPHFKEECH*SLEV 232 + IFMSHDWPL +TEYG+WEKLV+ KP F++E H LEV Sbjct: 168 IDIFMSHDWPLRITEYGNWEKLVRHKPFFRQEVHFCLEV 206 >ref|XP_020161992.1| lariat debranching enzyme [Aegilops tauschii subsp. tauschii] Length = 407 Score = 62.8 bits (151), Expect = 5e-09 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -1 Query: 351 PVAIFMSHDWPLGVTEYGDWEKLVQRKPHFKEECH 247 P+ IFMSHDWPLG+TEYG+WE+L++ KP F EE H Sbjct: 167 PLDIFMSHDWPLGITEYGNWERLLREKPFFTEEVH 201 >ref|XP_021900134.1| lariat debranching enzyme isoform X4 [Carica papaya] Length = 351 Score = 62.4 bits (150), Expect = 6e-09 Identities = 23/33 (69%), Positives = 31/33 (93%) Frame = -1 Query: 351 PVAIFMSHDWPLGVTEYGDWEKLVQRKPHFKEE 253 P+ IF+SHDWPLG+T+YGDW+KLVQ+K HF++E Sbjct: 170 PIDIFLSHDWPLGITDYGDWKKLVQQKRHFEKE 202 >ref|XP_021900133.1| lariat debranching enzyme isoform X3 [Carica papaya] Length = 385 Score = 62.4 bits (150), Expect = 7e-09 Identities = 23/33 (69%), Positives = 31/33 (93%) Frame = -1 Query: 351 PVAIFMSHDWPLGVTEYGDWEKLVQRKPHFKEE 253 P+ IF+SHDWPLG+T+YGDW+KLVQ+K HF++E Sbjct: 170 PIDIFLSHDWPLGITDYGDWKKLVQQKRHFEKE 202 >ref|XP_018839550.1| PREDICTED: lariat debranching enzyme isoform X4 [Juglans regia] Length = 416 Score = 62.4 bits (150), Expect = 7e-09 Identities = 23/33 (69%), Positives = 31/33 (93%) Frame = -1 Query: 351 PVAIFMSHDWPLGVTEYGDWEKLVQRKPHFKEE 253 P+ IF+SHDWPLG+T+YG WE+LV+RKP+FK+E Sbjct: 167 PIDIFLSHDWPLGITDYGKWEELVRRKPYFKKE 199 >ref|XP_021900132.1| lariat debranching enzyme isoform X2 [Carica papaya] Length = 422 Score = 62.4 bits (150), Expect = 7e-09 Identities = 23/33 (69%), Positives = 31/33 (93%) Frame = -1 Query: 351 PVAIFMSHDWPLGVTEYGDWEKLVQRKPHFKEE 253 P+ IF+SHDWPLG+T+YGDW+KLVQ+K HF++E Sbjct: 167 PIDIFLSHDWPLGITDYGDWKKLVQQKRHFEKE 199 >ref|XP_021900130.1| lariat debranching enzyme isoform X1 [Carica papaya] ref|XP_021900131.1| lariat debranching enzyme isoform X1 [Carica papaya] Length = 425 Score = 62.4 bits (150), Expect = 7e-09 Identities = 23/33 (69%), Positives = 31/33 (93%) Frame = -1 Query: 351 PVAIFMSHDWPLGVTEYGDWEKLVQRKPHFKEE 253 P+ IF+SHDWPLG+T+YGDW+KLVQ+K HF++E Sbjct: 170 PIDIFLSHDWPLGITDYGDWKKLVQQKRHFEKE 202 >ref|XP_018839549.1| PREDICTED: lariat debranching enzyme isoform X3 [Juglans regia] Length = 439 Score = 62.4 bits (150), Expect = 7e-09 Identities = 23/33 (69%), Positives = 31/33 (93%) Frame = -1 Query: 351 PVAIFMSHDWPLGVTEYGDWEKLVQRKPHFKEE 253 P+ IF+SHDWPLG+T+YG WE+LV+RKP+FK+E Sbjct: 167 PIDIFLSHDWPLGITDYGKWEELVRRKPYFKKE 199 >ref|XP_018839548.1| PREDICTED: lariat debranching enzyme isoform X2 [Juglans regia] Length = 454 Score = 62.4 bits (150), Expect = 7e-09 Identities = 23/33 (69%), Positives = 31/33 (93%) Frame = -1 Query: 351 PVAIFMSHDWPLGVTEYGDWEKLVQRKPHFKEE 253 P+ IF+SHDWPLG+T+YG WE+LV+RKP+FK+E Sbjct: 167 PIDIFLSHDWPLGITDYGKWEELVRRKPYFKKE 199 >ref|XP_018839547.1| PREDICTED: lariat debranching enzyme isoform X1 [Juglans regia] Length = 454 Score = 62.4 bits (150), Expect = 7e-09 Identities = 23/33 (69%), Positives = 31/33 (93%) Frame = -1 Query: 351 PVAIFMSHDWPLGVTEYGDWEKLVQRKPHFKEE 253 P+ IF+SHDWPLG+T+YG WE+LV+RKP+FK+E Sbjct: 167 PIDIFLSHDWPLGITDYGKWEELVRRKPYFKKE 199 >gb|OAY82687.1| Lariat debranching enzyme [Ananas comosus] Length = 403 Score = 61.6 bits (148), Expect = 1e-08 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -1 Query: 351 PVAIFMSHDWPLGVTEYGDWEKLVQRKPHFKEECH 247 P+ IF+SHDWPLG+TEYG+WEKL++ K HF EE + Sbjct: 177 PIDIFLSHDWPLGITEYGNWEKLIKSKRHFTEEVY 211 >ref|XP_020101377.1| lariat debranching enzyme isoform X1 [Ananas comosus] ref|XP_020101387.1| lariat debranching enzyme isoform X2 [Ananas comosus] ref|XP_020101396.1| lariat debranching enzyme isoform X1 [Ananas comosus] ref|XP_020101404.1| lariat debranching enzyme isoform X1 [Ananas comosus] Length = 408 Score = 61.2 bits (147), Expect = 2e-08 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -1 Query: 351 PVAIFMSHDWPLGVTEYGDWEKLVQRKPHFKEECH 247 P+ IF+SHDWPLG+TEYG+WEKL++ K HF EE + Sbjct: 167 PIDIFLSHDWPLGITEYGNWEKLIKIKQHFTEEVY 201