BLASTX nr result
ID: Ophiopogon22_contig00013353
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00013353 (416 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020679340.1| monothiol glutaredoxin-S10-like isoform X1 [... 80 5e-16 ref|XP_008789485.1| PREDICTED: monothiol glutaredoxin-S10 [Phoen... 79 1e-15 ref|XP_010940680.1| PREDICTED: monothiol glutaredoxin-S10 [Elaei... 79 2e-15 ref|XP_009405704.1| PREDICTED: monothiol glutaredoxin-S10 [Musa ... 79 2e-15 ref|XP_020574697.1| monothiol glutaredoxin-S10-like isoform X2 [... 79 2e-15 ref|XP_020273923.1| monothiol glutaredoxin-S10-like [Asparagus o... 77 5e-15 ref|XP_022157516.1| monothiol glutaredoxin-S10-like isoform X1 [... 77 7e-15 gb|OAY78341.1| Monothiol glutaredoxin-S10 [Ananas comosus] 77 8e-15 ref|XP_020091411.1| monothiol glutaredoxin-S10-like [Ananas como... 77 9e-15 gb|PKI76824.1| hypothetical protein CRG98_002810 [Punica granatum] 75 1e-14 pdb|3FZ9|A Chain A, Crystal Structure Of Poplar Glutaredoxin S12... 74 2e-14 ref|XP_012829029.1| PREDICTED: monothiol glutaredoxin-S10-like [... 75 3e-14 ref|XP_022991298.1| monothiol glutaredoxin-S10-like [Cucurbita m... 74 7e-14 ref|XP_022954295.1| glutaredoxin-C5, chloroplastic-like [Cucurbi... 74 8e-14 ref|XP_023549357.1| glutaredoxin-C5, chloroplastic-like [Cucurbi... 74 8e-14 gb|ACJ60637.1| glutaredoxin S12 [Populus tremula x Populus tremu... 74 9e-14 ref|XP_006386902.1| hypothetical protein POPTR_0002s25540g [Popu... 74 9e-14 ref|XP_006659715.1| PREDICTED: LOW QUALITY PROTEIN: monothiol gl... 74 1e-13 emb|CBI37229.3| unnamed protein product, partial [Vitis vinifera] 72 1e-13 gb|PPD95847.1| hypothetical protein GOBAR_DD07105 [Gossypium bar... 74 1e-13 >ref|XP_020679340.1| monothiol glutaredoxin-S10-like isoform X1 [Dendrobium catenatum] gb|PKU67150.1| Monothiol glutaredoxin-S10 [Dendrobium catenatum] Length = 195 Score = 80.5 bits (197), Expect = 5e-16 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = +3 Query: 3 RLTKQHTVPNVFVGGKHIGGCTDTKKLHNKGELIPLLSELNINTK 137 RLT Q TVPNVF+GGKHIGGCTDT KL+ KGEL P+LSELNINTK Sbjct: 146 RLTGQFTVPNVFIGGKHIGGCTDTVKLYRKGELTPMLSELNINTK 190 >ref|XP_008789485.1| PREDICTED: monothiol glutaredoxin-S10 [Phoenix dactylifera] Length = 181 Score = 79.0 bits (193), Expect = 1e-15 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = +3 Query: 3 RLTKQHTVPNVFVGGKHIGGCTDTKKLHNKGELIPLLSELNINTK 137 RLT Q+TVPNVF+GGKHIGGCTDT KLH+KGEL LLS+LNI+TK Sbjct: 132 RLTGQYTVPNVFIGGKHIGGCTDTVKLHHKGELTTLLSDLNISTK 176 >ref|XP_010940680.1| PREDICTED: monothiol glutaredoxin-S10 [Elaeis guineensis] Length = 180 Score = 78.6 bits (192), Expect = 2e-15 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = +3 Query: 3 RLTKQHTVPNVFVGGKHIGGCTDTKKLHNKGELIPLLSELNINTK 137 RLT Q+TVPNVF+GGKHIGGCTDT KLH+KGEL LLS+LNI TK Sbjct: 131 RLTGQYTVPNVFIGGKHIGGCTDTVKLHHKGELTTLLSDLNIGTK 175 >ref|XP_009405704.1| PREDICTED: monothiol glutaredoxin-S10 [Musa acuminata subsp. malaccensis] Length = 188 Score = 78.6 bits (192), Expect = 2e-15 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 3 RLTKQHTVPNVFVGGKHIGGCTDTKKLHNKGELIPLLSELNINTK 137 RLT QHTVPNVF+GGKHIGGCTDT KLH KGEL LLS+LNI T+ Sbjct: 143 RLTGQHTVPNVFIGGKHIGGCTDTVKLHQKGELTTLLSKLNIGTE 187 >ref|XP_020574697.1| monothiol glutaredoxin-S10-like isoform X2 [Phalaenopsis equestris] Length = 190 Score = 78.6 bits (192), Expect = 2e-15 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = +3 Query: 3 RLTKQHTVPNVFVGGKHIGGCTDTKKLHNKGELIPLLSELNINTK 137 RLT Q TVPNVF+GGKHIGGCTDT KL+ KGEL P+LSELNI+TK Sbjct: 141 RLTGQFTVPNVFIGGKHIGGCTDTVKLYRKGELTPMLSELNISTK 185 >ref|XP_020273923.1| monothiol glutaredoxin-S10-like [Asparagus officinalis] gb|ONK63832.1| uncharacterized protein A4U43_C07F19400 [Asparagus officinalis] Length = 179 Score = 77.4 bits (189), Expect = 5e-15 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 3 RLTKQHTVPNVFVGGKHIGGCTDTKKLHNKGELIPLLSELNINTK 137 RLT Q TVPNVF+GGKHIGGCTDT +LH+KGEL LLSELNI TK Sbjct: 130 RLTGQFTVPNVFIGGKHIGGCTDTVRLHHKGELTTLLSELNIKTK 174 >ref|XP_022157516.1| monothiol glutaredoxin-S10-like isoform X1 [Momordica charantia] Length = 177 Score = 77.0 bits (188), Expect = 7e-15 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +3 Query: 3 RLTKQHTVPNVFVGGKHIGGCTDTKKLHNKGELIPLLSELN 125 RLT QHTVPNVF+GGKHIGGCTDT KLH KGEL PLLSE N Sbjct: 131 RLTGQHTVPNVFIGGKHIGGCTDTMKLHRKGELEPLLSEAN 171 >gb|OAY78341.1| Monothiol glutaredoxin-S10 [Ananas comosus] Length = 186 Score = 77.0 bits (188), Expect = 8e-15 Identities = 36/45 (80%), Positives = 38/45 (84%) Frame = +3 Query: 3 RLTKQHTVPNVFVGGKHIGGCTDTKKLHNKGELIPLLSELNINTK 137 RLT Q TVPNVF+GGKHIGGCTDT KL+ KGEL PLLSELNI K Sbjct: 137 RLTGQSTVPNVFIGGKHIGGCTDTVKLYQKGELTPLLSELNIGAK 181 >ref|XP_020091411.1| monothiol glutaredoxin-S10-like [Ananas comosus] gb|OAY68089.1| Monothiol glutaredoxin-S10 [Ananas comosus] Length = 187 Score = 77.0 bits (188), Expect = 9e-15 Identities = 36/45 (80%), Positives = 38/45 (84%) Frame = +3 Query: 3 RLTKQHTVPNVFVGGKHIGGCTDTKKLHNKGELIPLLSELNINTK 137 RLT Q TVPNVF+GGKHIGGCTDT KL+ KGEL PLLSELNI K Sbjct: 138 RLTGQSTVPNVFIGGKHIGGCTDTVKLYQKGELTPLLSELNIGAK 182 >gb|PKI76824.1| hypothetical protein CRG98_002810 [Punica granatum] Length = 118 Score = 74.7 bits (182), Expect = 1e-14 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = +3 Query: 3 RLTKQHTVPNVFVGGKHIGGCTDTKKLHNKGELIPLLSELNIN 131 RLT QHTVPNVF+GGKHIGGC+DT KL+ KGEL PLLSE N N Sbjct: 74 RLTGQHTVPNVFIGGKHIGGCSDTVKLYRKGELEPLLSEANAN 116 >pdb|3FZ9|A Chain A, Crystal Structure Of Poplar Glutaredoxin S12 In Complex With Glutathione pdb|3FZA|A Chain A, Crystal Structure Of Poplar Glutaredoxin S12 In Complex With Glutathione And Beta-Mercaptoethanol Length = 112 Score = 74.3 bits (181), Expect = 2e-14 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 3 RLTKQHTVPNVFVGGKHIGGCTDTKKLHNKGELIPLLSELN 125 RLT QHTVPNVF+GGKHIGGCTDT KL+ KGEL PLLSE N Sbjct: 66 RLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEAN 106 >ref|XP_012829029.1| PREDICTED: monothiol glutaredoxin-S10-like [Erythranthe guttata] gb|EYU17959.1| hypothetical protein MIMGU_mgv1a014885mg [Erythranthe guttata] Length = 174 Score = 75.5 bits (184), Expect = 3e-14 Identities = 36/43 (83%), Positives = 36/43 (83%) Frame = +3 Query: 3 RLTKQHTVPNVFVGGKHIGGCTDTKKLHNKGELIPLLSELNIN 131 RLT QHTVPNVFVGGKHIGGCTDT KLH KGEL PLLSE N Sbjct: 131 RLTGQHTVPNVFVGGKHIGGCTDTVKLHRKGELEPLLSEAVAN 173 >ref|XP_022991298.1| monothiol glutaredoxin-S10-like [Cucurbita maxima] Length = 175 Score = 74.3 bits (181), Expect = 7e-14 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 3 RLTKQHTVPNVFVGGKHIGGCTDTKKLHNKGELIPLLSELN 125 RLT QHTVPNVF+GGKHIGGCTDT KL+ KGEL PLLSE N Sbjct: 129 RLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEAN 169 >ref|XP_022954295.1| glutaredoxin-C5, chloroplastic-like [Cucurbita moschata] Length = 180 Score = 74.3 bits (181), Expect = 8e-14 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 3 RLTKQHTVPNVFVGGKHIGGCTDTKKLHNKGELIPLLSELN 125 RLT QHTVPNVF+GGKHIGGCTDT KL+ KGEL PLLSE N Sbjct: 134 RLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEAN 174 >ref|XP_023549357.1| glutaredoxin-C5, chloroplastic-like [Cucurbita pepo subsp. pepo] Length = 182 Score = 74.3 bits (181), Expect = 8e-14 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 3 RLTKQHTVPNVFVGGKHIGGCTDTKKLHNKGELIPLLSELN 125 RLT QHTVPNVF+GGKHIGGCTDT KL+ KGEL PLLSE N Sbjct: 136 RLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEAN 176 >gb|ACJ60637.1| glutaredoxin S12 [Populus tremula x Populus tremuloides] Length = 185 Score = 74.3 bits (181), Expect = 9e-14 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 3 RLTKQHTVPNVFVGGKHIGGCTDTKKLHNKGELIPLLSELN 125 RLT QHTVPNVF+GGKHIGGCTDT KL+ KGEL PLLSE N Sbjct: 139 RLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEAN 179 >ref|XP_006386902.1| hypothetical protein POPTR_0002s25540g [Populus trichocarpa] gb|ABK93540.1| unknown [Populus trichocarpa] gb|PNT51656.1| hypothetical protein POPTR_002G254100v3 [Populus trichocarpa] Length = 185 Score = 74.3 bits (181), Expect = 9e-14 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 3 RLTKQHTVPNVFVGGKHIGGCTDTKKLHNKGELIPLLSELN 125 RLT QHTVPNVF+GGKHIGGCTDT KL+ KGEL PLLSE N Sbjct: 139 RLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEAN 179 >ref|XP_006659715.1| PREDICTED: LOW QUALITY PROTEIN: monothiol glutaredoxin-S10-like [Oryza brachyantha] Length = 172 Score = 73.9 bits (180), Expect = 1e-13 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = +3 Query: 3 RLTKQHTVPNVFVGGKHIGGCTDTKKLHNKGELIPLLSELNIN 131 RLT Q TVPNVF+GGKHIGGCTDT KLH KGEL +LSEL+IN Sbjct: 126 RLTGQSTVPNVFIGGKHIGGCTDTVKLHRKGELATMLSELDIN 168 >emb|CBI37229.3| unnamed protein product, partial [Vitis vinifera] Length = 114 Score = 72.4 bits (176), Expect = 1e-13 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 RLTKQHTVPNVFVGGKHIGGCTDTKKLHNKGELIPLLSE 119 RLT QHTVPNVF+GGKHIGGCTDT KL+ KGEL PLLSE Sbjct: 68 RLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSE 106 >gb|PPD95847.1| hypothetical protein GOBAR_DD07105 [Gossypium barbadense] Length = 175 Score = 73.9 bits (180), Expect = 1e-13 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = +3 Query: 3 RLTKQHTVPNVFVGGKHIGGCTDTKKLHNKGELIPLLSELNINTK 137 RLT QHTVPNVF+GGKHIGGCTDT KL+ KGEL PLLSE +K Sbjct: 129 RLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEATAKSK 173