BLASTX nr result
ID: Ophiopogon22_contig00013286
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00013286 (391 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020260677.1| ubiquinol oxidase 2, mitochondrial-like [Asp... 62 9e-09 >ref|XP_020260677.1| ubiquinol oxidase 2, mitochondrial-like [Asparagus officinalis] gb|ONK71587.1| uncharacterized protein A4U43_C04F10230 [Asparagus officinalis] Length = 329 Score = 62.4 bits (150), Expect = 9e-09 Identities = 38/71 (53%), Positives = 43/71 (60%) Frame = +1 Query: 112 MLSSSRMARSTVLRQLGPRLFSTSAVARPAAIEHXXXXXXXXXXXXPVRSPAVWVRVFPV 291 MLSS+R+ RS++L LGPRLFSTSAV R PV S VWVRV PV Sbjct: 1 MLSSTRIVRSSLLNHLGPRLFSTSAVTR-----------------SPVGSSEVWVRVSPV 43 Query: 292 RFASTGASQAA 324 RFAST A+ AA Sbjct: 44 RFASTEATTAA 54