BLASTX nr result
ID: Ophiopogon22_contig00011968
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00011968 (367 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020271396.1| transcription termination factor MTERF4, chl... 77 6e-14 >ref|XP_020271396.1| transcription termination factor MTERF4, chloroplastic [Asparagus officinalis] gb|ONK62881.1| uncharacterized protein A4U43_C07F9100 [Asparagus officinalis] Length = 514 Score = 77.0 bits (188), Expect = 6e-14 Identities = 42/68 (61%), Positives = 48/68 (70%) Frame = +1 Query: 163 MKLIANPNNIPKPSILSSGCLTHQNPFAKILTFALNPNEFKLRTTPTRAHAASSTYTPMP 342 MKLI +P +PK S+LSSGCLTH+NPFAKILTF N E KL P RA+AA ST P Sbjct: 1 MKLITDPI-MPKTSVLSSGCLTHRNPFAKILTFTRNHGECKL---PARAYAAYSTSAPKR 56 Query: 343 AHSPIHGR 366 A P+HGR Sbjct: 57 ASPPVHGR 64