BLASTX nr result
ID: Ophiopogon22_contig00010824
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00010824 (397 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020258833.1| probable serine/threonine protein kinase IRE... 57 9e-07 >ref|XP_020258833.1| probable serine/threonine protein kinase IRE [Asparagus officinalis] Length = 1100 Score = 57.0 bits (136), Expect = 9e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 6 DFRAPKTYSFSNFPFKNISQLASINYDLITK 98 +F APK YSFSNF FKNISQLASINYDLITK Sbjct: 1059 EFGAPKKYSFSNFSFKNISQLASINYDLITK 1089