BLASTX nr result
ID: Ophiopogon22_contig00010377
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00010377 (2081 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020269278.1| histone deacetylase 2 isoform X1 [Asparagus ... 62 2e-06 >ref|XP_020269278.1| histone deacetylase 2 isoform X1 [Asparagus officinalis] gb|ONK66694.1| uncharacterized protein A4U43_C06F11000 [Asparagus officinalis] Length = 356 Score = 61.6 bits (148), Expect = 2e-06 Identities = 39/68 (57%), Positives = 46/68 (67%), Gaps = 2/68 (2%) Frame = -1 Query: 917 IRNEKVFRFAREKDASLLMLTSG--ILITFRLIIKKLLSFCLYIH*FADSISNLSKKRLL 744 IR+EKVFRFAREKD LLMLTSG + + R+I ADSI+NLSKKRL+ Sbjct: 302 IRDEKVFRFAREKDIPLLMLTSGGYMKTSARVI--------------ADSITNLSKKRLI 347 Query: 743 DLESLQSR 720 D+E LQSR Sbjct: 348 DMEVLQSR 355