BLASTX nr result
ID: Ophiopogon22_contig00010283
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00010283 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020081813.1| probable ribosomal protein S11, mitochondria... 64 1e-09 ref|YP_009315970.1| ribosomal protein S11 (mitochondrion) [Cocos... 62 3e-09 ref|YP_005090385.1| ribosomal protein S11 (mitochondrion) [Phoen... 62 5e-09 gb|AVL84850.1| ribosomal protein S11 (mitochondrion) [Gastrodia ... 58 1e-07 ref|YP_007905718.1| ribosomal protein S11 (mitochondrion) [Lirio... 57 3e-07 ref|YP_009270687.1| ribosomal protein S11 (mitochondrion) [Nelum... 56 5e-07 gb|AVI15767.1| ribosomal protein S11 (mitochondrion) [Nymphaea c... 55 2e-06 gb|KUM49623.1| ribosomal protein S11 (mitochondrion) [Picea glauca] 53 7e-06 ref|NP_001148535.1| ribosomal protein S11 containing protein [Ze... 54 8e-06 gb|PAN37967.1| hypothetical protein PAHAL_F00845 [Panicum hallii... 54 8e-06 ref|XP_014661071.1| uncharacterized protein LOC106804446 [Setari... 54 8e-06 gb|OEL21122.1| hypothetical protein BAE44_0017859 [Dichanthelium... 54 1e-05 >ref|XP_020081813.1| probable ribosomal protein S11, mitochondrial [Ananas comosus] Length = 188 Score = 63.5 bits (153), Expect = 1e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 409 FRGEGVGVKSRILSIYDVTQLPHNGCRLPKKRRV 308 FRGEGVG KS I+ I+DVTQLPHNGCRLPKKRRV Sbjct: 148 FRGEGVGKKSPIMYIHDVTQLPHNGCRLPKKRRV 181 >ref|YP_009315970.1| ribosomal protein S11 (mitochondrion) [Cocos nucifera] gb|AOX12964.1| ribosomal protein S11 (mitochondrion) [Cocos nucifera] Length = 149 Score = 61.6 bits (148), Expect = 3e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 409 FRGEGVGVKSRILSIYDVTQLPHNGCRLPKKRRV 308 FRGEGVG +S I+ I+DVTQLPHNGCRLPKKRRV Sbjct: 109 FRGEGVGDQSPIMYIHDVTQLPHNGCRLPKKRRV 142 >ref|YP_005090385.1| ribosomal protein S11 (mitochondrion) [Phoenix dactylifera] gb|AEM43925.1| ribosomal protein S11 (mitochondrion) [Phoenix dactylifera] Length = 171 Score = 61.6 bits (148), Expect = 5e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 409 FRGEGVGVKSRILSIYDVTQLPHNGCRLPKKRRV 308 FRGEGVG +S I+ I+DVTQLPHNGCRLPKKRRV Sbjct: 109 FRGEGVGDQSPIMYIHDVTQLPHNGCRLPKKRRV 142 >gb|AVL84850.1| ribosomal protein S11 (mitochondrion) [Gastrodia elata] Length = 153 Score = 57.8 bits (138), Expect = 1e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 409 FRGEGVGVKSRILSIYDVTQLPHNGCRLPKKRRV 308 FRG GVG +S IL I+DVTQL HNGCRLPKKRRV Sbjct: 113 FRGSGVGDQSTILYIHDVTQLSHNGCRLPKKRRV 146 >ref|YP_007905718.1| ribosomal protein S11 (mitochondrion) [Liriodendron tulipifera] gb|AGJ90415.1| ribosomal protein S11 (mitochondrion) [Liriodendron tulipifera] Length = 172 Score = 57.0 bits (136), Expect = 3e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 406 RGEGVGVKSRILSIYDVTQLPHNGCRLPKKRRV 308 R EGVG +S+I+ I+DVTQLPHNGCRLP+KRRV Sbjct: 139 RSEGVGDQSQIMYIHDVTQLPHNGCRLPRKRRV 171 >ref|YP_009270687.1| ribosomal protein S11 (mitochondrion) [Nelumbo nucifera] gb|ALL55140.1| ribosomal protein S11 (mitochondrion) [Nelumbo nucifera] Length = 148 Score = 55.8 bits (133), Expect = 5e-07 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -1 Query: 406 RGEGVGVKSRILSIYDVTQLPHNGCRLPKKRRV 308 R +GVG +S+I+ I+DVTQLPHNGCRLP+KRRV Sbjct: 115 RSKGVGDQSKIMYIHDVTQLPHNGCRLPRKRRV 147 >gb|AVI15767.1| ribosomal protein S11 (mitochondrion) [Nymphaea colorata] Length = 170 Score = 54.7 bits (130), Expect = 2e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -1 Query: 406 RGEGVGVKSRILSIYDVTQLPHNGCRLPKKRR 311 R EGVG S I+ I+DVTQLPHNGCRLP+KRR Sbjct: 138 RSEGVGQPSNIMYIHDVTQLPHNGCRLPRKRR 169 >gb|KUM49623.1| ribosomal protein S11 (mitochondrion) [Picea glauca] Length = 170 Score = 53.1 bits (126), Expect = 7e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 400 EGVGVKSRILSIYDVTQLPHNGCRLPKKRRV 308 +GVG+KS I+ I+DVTQL HNGCRLP+KRRV Sbjct: 140 KGVGIKSLIMYIHDVTQLSHNGCRLPRKRRV 170 >ref|NP_001148535.1| ribosomal protein S11 containing protein [Zea mays] ref|XP_020397719.1| ribosomal protein S11 containing protein isoform X1 [Zea mays] gb|ACG31875.1| ribosomal protein S11 containing protein [Zea mays] gb|ACN31110.1| unknown [Zea mays] gb|AQK91967.1| putative ribosomal protein S11 mitochondrial [Zea mays] gb|AQK91968.1| putative ribosomal protein S11 mitochondrial [Zea mays] Length = 252 Score = 53.9 bits (128), Expect = 8e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 409 FRGEGVGVKSRILSIYDVTQLPHNGCRLPKKRRV 308 FRGE V +S I+ I+DVTQLPHNGCRLPK+RRV Sbjct: 219 FRGERVRDQSPIMYIHDVTQLPHNGCRLPKQRRV 252 >gb|PAN37967.1| hypothetical protein PAHAL_F00845 [Panicum hallii] gb|PAN37968.1| hypothetical protein PAHAL_F00845 [Panicum hallii] Length = 261 Score = 53.9 bits (128), Expect = 8e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 409 FRGEGVGVKSRILSIYDVTQLPHNGCRLPKKRRV 308 FRGE V +S I+ I+DVTQLPHNGCRLPK+RRV Sbjct: 228 FRGERVRDQSPIMYIHDVTQLPHNGCRLPKQRRV 261 >ref|XP_014661071.1| uncharacterized protein LOC106804446 [Setaria italica] gb|KQK97133.1| hypothetical protein SETIT_010861mg [Setaria italica] Length = 262 Score = 53.9 bits (128), Expect = 8e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 409 FRGEGVGVKSRILSIYDVTQLPHNGCRLPKKRRV 308 FRGE V +S I+ I+DVTQLPHNGCRLPK+RRV Sbjct: 229 FRGERVRDQSPIMYIHDVTQLPHNGCRLPKQRRV 262 >gb|OEL21122.1| hypothetical protein BAE44_0017859 [Dichanthelium oligosanthes] Length = 297 Score = 53.9 bits (128), Expect = 1e-05 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 409 FRGEGVGVKSRILSIYDVTQLPHNGCRLPKKRRV 308 FRGE V +S I+ I+DVTQLPHNGCRLPK+RRV Sbjct: 264 FRGERVRDQSPIMYIHDVTQLPHNGCRLPKQRRV 297