BLASTX nr result
ID: Ophiopogon22_contig00010008
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00010008 (488 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020261235.1| heterogeneous nuclear ribonucleoprotein Q-li... 68 3e-10 >ref|XP_020261235.1| heterogeneous nuclear ribonucleoprotein Q-like [Asparagus officinalis] gb|ONK72154.1| uncharacterized protein A4U43_C04F16350 [Asparagus officinalis] Length = 557 Score = 68.2 bits (165), Expect = 3e-10 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -1 Query: 125 HQDQDQVQEDFRIEVDEQMEISDMAKVRKIKKEQEIFVGGL 3 HQD+DQ QED +EVD +MEISDMAK RKIKKE+EIFVGGL Sbjct: 45 HQDEDQAQEDAGVEVDVEMEISDMAKARKIKKEREIFVGGL 85