BLASTX nr result
ID: Ophiopogon22_contig00009940
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00009940 (851 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020275318.1| uncharacterized protein LOC109849844 [Aspara... 58 1e-05 >ref|XP_020275318.1| uncharacterized protein LOC109849844 [Asparagus officinalis] gb|ONK64816.1| uncharacterized protein A4U43_C07F30260 [Asparagus officinalis] Length = 539 Score = 57.8 bits (138), Expect = 1e-05 Identities = 28/55 (50%), Positives = 36/55 (65%) Frame = +1 Query: 625 MGKSRLKLRSTAYQRQMEFCMSDQSRFEKNKLVLFDPYDDEDEVSSFDPCVDQDD 789 MG SRL ++S A+ +Q EF DQSR EKNKLV +DP+ ED + +P QDD Sbjct: 1 MGGSRLSVKSAAFAKQAEFYKKDQSRLEKNKLVTWDPFYSEDGLLLLEPLDTQDD 55