BLASTX nr result
ID: Ophiopogon22_contig00009624
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00009624 (426 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK64083.1| uncharacterized protein A4U43_C07F21910 [Asparagu... 68 2e-11 gb|ONK80560.1| uncharacterized protein A4U43_C01F19190 [Asparagu... 63 2e-09 >gb|ONK64083.1| uncharacterized protein A4U43_C07F21910 [Asparagus officinalis] Length = 162 Score = 67.8 bits (164), Expect = 2e-11 Identities = 31/59 (52%), Positives = 44/59 (74%) Frame = -3 Query: 178 GSDQGHGHV*DSIAAHKPKRHTRRPAKFDDMILAYALPVEVIEDSIPSTYREAELGSES 2 G Q HGHV +SIAA++P+ RR ++D+I+AYAL +EV++D +PST+REAE S S Sbjct: 12 GETQEHGHVQESIAANRPRMVIRRLTTYNDVIVAYALSIEVVDDMVPSTFREAESSSNS 70 >gb|ONK80560.1| uncharacterized protein A4U43_C01F19190 [Asparagus officinalis] Length = 209 Score = 63.2 bits (152), Expect = 2e-09 Identities = 28/63 (44%), Positives = 44/63 (69%) Frame = -3 Query: 190 EIPGGSDQGHGHV*DSIAAHKPKRHTRRPAKFDDMILAYALPVEVIEDSIPSTYREAELG 11 +I G Q GH SI A +P+R R PA+++D+++AYAL V+V++D +PST+R+AE Sbjct: 15 DIVDGEAQEQGHTQGSIVADRPRREIRWPARYNDVMVAYALSVKVVDDLVPSTFRDAEFS 74 Query: 10 SES 2 +S Sbjct: 75 PDS 77