BLASTX nr result
ID: Ophiopogon22_contig00009490
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00009490 (482 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK60486.1| uncharacterized protein A4U43_C08F18990 [Asparagu... 55 7e-06 ref|XP_020243105.1| LOW QUALITY PROTEIN: serine/threonine-protei... 55 7e-06 >gb|ONK60486.1| uncharacterized protein A4U43_C08F18990 [Asparagus officinalis] Length = 961 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +1 Query: 4 ALKSLQRLVIPAHQESPSTPLPQEIPVNSTP 96 ALKSLQRL+IP HQES STPLPQEI VNSTP Sbjct: 931 ALKSLQRLMIPPHQESQSTPLPQEIHVNSTP 961 >ref|XP_020243105.1| LOW QUALITY PROTEIN: serine/threonine-protein kinase EDR1-like, partial [Asparagus officinalis] Length = 996 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +1 Query: 4 ALKSLQRLVIPAHQESPSTPLPQEIPVNSTP 96 ALKSLQRL+IP HQES STPLPQEI VNSTP Sbjct: 966 ALKSLQRLMIPPHQESQSTPLPQEIHVNSTP 996