BLASTX nr result
ID: Ophiopogon22_contig00009463
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00009463 (540 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020269713.1| ubiquitin-conjugating enzyme E2 34-like isof... 59 4e-07 ref|XP_020269712.1| ubiquitin-conjugating enzyme E2 34-like isof... 57 2e-06 >ref|XP_020269713.1| ubiquitin-conjugating enzyme E2 34-like isoform X2 [Asparagus officinalis] gb|ONK66004.1| uncharacterized protein A4U43_C06F3190 [Asparagus officinalis] Length = 239 Score = 58.5 bits (140), Expect = 4e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +3 Query: 438 LFFFADSKNCPNFKKLFPEYVQKFEQLRAPEQS 536 L + +SKNCPNFKKLFPEYV+K+E+LRAPEQS Sbjct: 140 LAYNCESKNCPNFKKLFPEYVEKYEKLRAPEQS 172 >ref|XP_020269712.1| ubiquitin-conjugating enzyme E2 34-like isoform X1 [Asparagus officinalis] Length = 240 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = +3 Query: 456 SKNCPNFKKLFPEYVQKFEQLRAPEQS 536 SKNCPNFKKLFPEYV+K+E+LRAPEQS Sbjct: 147 SKNCPNFKKLFPEYVEKYEKLRAPEQS 173