BLASTX nr result
ID: Ophiopogon22_contig00009385
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00009385 (715 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEJ90540.1| CalS5-like protein, partial [Austrobaileya scandens] 80 1e-14 gb|AEJ90542.1| CalS5-like protein, partial [Nuphar advena] 79 2e-14 gb|AEJ90541.1| CalS5-like protein, partial [Trithuria austinensi... 79 2e-14 gb|KZN01480.1| hypothetical protein DCAR_010255 [Daucus carota s... 81 7e-14 ref|XP_017239565.1| PREDICTED: callose synthase 5-like [Daucus c... 81 7e-14 gb|AEJ90544.1| CalS5-like protein, partial [Ginkgo biloba] 77 1e-13 ref|XP_021813647.1| callose synthase 5 [Prunus avium] 80 2e-13 gb|KDO58319.1| hypothetical protein CISIN_1g0457372mg, partial [... 80 2e-13 gb|ESR45475.1| hypothetical protein CICLE_v10000018mg [Citrus cl... 80 2e-13 ref|XP_017178860.1| PREDICTED: callose synthase 5-like, partial ... 80 2e-13 gb|ONI14251.1| hypothetical protein PRUPE_4G271000 [Prunus persica] 80 2e-13 dbj|GAY56883.1| hypothetical protein CUMW_175300 [Citrus unshiu] 80 2e-13 dbj|GAY56882.1| hypothetical protein CUMW_175300 [Citrus unshiu] 80 2e-13 ref|XP_016648608.1| PREDICTED: LOW QUALITY PROTEIN: callose synt... 80 2e-13 ref|XP_015383388.1| PREDICTED: callose synthase 5 [Citrus sinensis] 80 2e-13 ref|XP_020418283.1| callose synthase 5 [Prunus persica] 80 2e-13 ref|XP_009374206.1| PREDICTED: callose synthase 5 [Pyrus x brets... 80 2e-13 ref|XP_008342870.1| PREDICTED: callose synthase 5-like [Malus do... 80 2e-13 ref|XP_024038938.1| LOW QUALITY PROTEIN: callose synthase 5 [Cit... 80 2e-13 gb|ONK59562.1| uncharacterized protein A4U43_C08F7740 [Asparagus... 79 3e-13 >gb|AEJ90540.1| CalS5-like protein, partial [Austrobaileya scandens] Length = 189 Score = 79.7 bits (195), Expect = 1e-14 Identities = 39/43 (90%), Positives = 40/43 (93%) Frame = -3 Query: 713 VKESVVDVPTNLEARRRITFFTNSLFMDTPRAPRVRKMLSFSL 585 VKES VDVPTNLEARRRI FFTNSLFMD PRAPRVRKMLSFS+ Sbjct: 66 VKESAVDVPTNLEARRRIAFFTNSLFMDMPRAPRVRKMLSFSV 108 >gb|AEJ90542.1| CalS5-like protein, partial [Nuphar advena] Length = 200 Score = 79.3 bits (194), Expect = 2e-14 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -3 Query: 713 VKESVVDVPTNLEARRRITFFTNSLFMDTPRAPRVRKMLSFSL 585 VKES +DVPTNLEARRRI FFTNSLFMD PRAPRVRKMLSFS+ Sbjct: 77 VKESAIDVPTNLEARRRIAFFTNSLFMDMPRAPRVRKMLSFSV 119 >gb|AEJ90541.1| CalS5-like protein, partial [Trithuria austinensis] gb|AEJ90543.1| CalS5-like protein, partial [Nymphaea odorata] Length = 200 Score = 79.3 bits (194), Expect = 2e-14 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -3 Query: 713 VKESVVDVPTNLEARRRITFFTNSLFMDTPRAPRVRKMLSFSL 585 VKES +DVPTNLEARRRI FFTNSLFMD PRAPRVRKMLSFS+ Sbjct: 77 VKESAIDVPTNLEARRRIAFFTNSLFMDMPRAPRVRKMLSFSV 119 >gb|KZN01480.1| hypothetical protein DCAR_010255 [Daucus carota subsp. sativus] Length = 1924 Score = 81.3 bits (199), Expect = 7e-14 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = -3 Query: 713 VKESVVDVPTNLEARRRITFFTNSLFMDTPRAPRVRKMLSFSL 585 VKES +DVPTNLEARRRITFFTNSLFMD PRAPRVRKMLSFS+ Sbjct: 1039 VKESAIDVPTNLEARRRITFFTNSLFMDMPRAPRVRKMLSFSV 1081 >ref|XP_017239565.1| PREDICTED: callose synthase 5-like [Daucus carota subsp. sativus] Length = 1936 Score = 81.3 bits (199), Expect = 7e-14 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = -3 Query: 713 VKESVVDVPTNLEARRRITFFTNSLFMDTPRAPRVRKMLSFSL 585 VKES +DVPTNLEARRRITFFTNSLFMD PRAPRVRKMLSFS+ Sbjct: 1051 VKESAIDVPTNLEARRRITFFTNSLFMDMPRAPRVRKMLSFSV 1093 >gb|AEJ90544.1| CalS5-like protein, partial [Ginkgo biloba] Length = 200 Score = 77.4 bits (189), Expect = 1e-13 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -3 Query: 713 VKESVVDVPTNLEARRRITFFTNSLFMDTPRAPRVRKMLSFSL 585 VKES +DVPTNLEARRRITFF+NSLFMD PRAP VRKMLSFS+ Sbjct: 77 VKESAIDVPTNLEARRRITFFSNSLFMDMPRAPSVRKMLSFSV 119 >ref|XP_021813647.1| callose synthase 5 [Prunus avium] Length = 1918 Score = 80.1 bits (196), Expect = 2e-13 Identities = 42/61 (68%), Positives = 48/61 (78%) Frame = -3 Query: 713 VKESVVDVPTNLEARRRITFFTNSLFMDTPRAPRVRKMLSFSLNSSQGKWYIAQGTHFSY 534 VKES +DVPTNLEARRRI FFTNSLFMD PRAPRVRKMLSFS+ + Y ++ T +S Sbjct: 1030 VKESAIDVPTNLEARRRIAFFTNSLFMDMPRAPRVRKMLSFSIMTP----YYSEETVYSK 1085 Query: 533 A 531 A Sbjct: 1086 A 1086 >gb|KDO58319.1| hypothetical protein CISIN_1g0457372mg, partial [Citrus sinensis] Length = 1068 Score = 79.7 bits (195), Expect = 2e-13 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 713 VKESVVDVPTNLEARRRITFFTNSLFMDTPRAPRVRKMLSFSL 585 VKES +DVPTNLEARRRITFF+NSLFMD PRAPRVRKMLSFS+ Sbjct: 926 VKESAIDVPTNLEARRRITFFSNSLFMDMPRAPRVRKMLSFSV 968 >gb|ESR45475.1| hypothetical protein CICLE_v10000018mg [Citrus clementina] Length = 1715 Score = 79.7 bits (195), Expect = 2e-13 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 713 VKESVVDVPTNLEARRRITFFTNSLFMDTPRAPRVRKMLSFSL 585 VKES +DVPTNLEARRRITFF+NSLFMD PRAPRVRKMLSFS+ Sbjct: 825 VKESAIDVPTNLEARRRITFFSNSLFMDMPRAPRVRKMLSFSV 867 >ref|XP_017178860.1| PREDICTED: callose synthase 5-like, partial [Malus domestica] Length = 1848 Score = 79.7 bits (195), Expect = 2e-13 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -3 Query: 713 VKESVVDVPTNLEARRRITFFTNSLFMDTPRAPRVRKMLSFSL 585 VKES +DVPTNLEARRRI FFTNSLFMD PRAPRVRKMLSFS+ Sbjct: 959 VKESAIDVPTNLEARRRIAFFTNSLFMDMPRAPRVRKMLSFSI 1001 >gb|ONI14251.1| hypothetical protein PRUPE_4G271000 [Prunus persica] Length = 1857 Score = 79.7 bits (195), Expect = 2e-13 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -3 Query: 713 VKESVVDVPTNLEARRRITFFTNSLFMDTPRAPRVRKMLSFSL 585 VKES +DVPTNLEARRRI FFTNSLFMD PRAPRVRKMLSFS+ Sbjct: 969 VKESAIDVPTNLEARRRIAFFTNSLFMDMPRAPRVRKMLSFSI 1011 >dbj|GAY56883.1| hypothetical protein CUMW_175300 [Citrus unshiu] Length = 1870 Score = 79.7 bits (195), Expect = 2e-13 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 713 VKESVVDVPTNLEARRRITFFTNSLFMDTPRAPRVRKMLSFSL 585 VKES +DVPTNLEARRRITFF+NSLFMD PRAPRVRKMLSFS+ Sbjct: 1114 VKESAIDVPTNLEARRRITFFSNSLFMDMPRAPRVRKMLSFSV 1156 >dbj|GAY56882.1| hypothetical protein CUMW_175300 [Citrus unshiu] Length = 1892 Score = 79.7 bits (195), Expect = 2e-13 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 713 VKESVVDVPTNLEARRRITFFTNSLFMDTPRAPRVRKMLSFSL 585 VKES +DVPTNLEARRRITFF+NSLFMD PRAPRVRKMLSFS+ Sbjct: 1114 VKESAIDVPTNLEARRRITFFSNSLFMDMPRAPRVRKMLSFSV 1156 >ref|XP_016648608.1| PREDICTED: LOW QUALITY PROTEIN: callose synthase 5 [Prunus mume] Length = 1906 Score = 79.7 bits (195), Expect = 2e-13 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -3 Query: 713 VKESVVDVPTNLEARRRITFFTNSLFMDTPRAPRVRKMLSFSL 585 VKES +DVPTNLEARRRI FFTNSLFMD PRAPRVRKMLSFS+ Sbjct: 1030 VKESAIDVPTNLEARRRIAFFTNSLFMDMPRAPRVRKMLSFSI 1072 >ref|XP_015383388.1| PREDICTED: callose synthase 5 [Citrus sinensis] Length = 1917 Score = 79.7 bits (195), Expect = 2e-13 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 713 VKESVVDVPTNLEARRRITFFTNSLFMDTPRAPRVRKMLSFSL 585 VKES +DVPTNLEARRRITFF+NSLFMD PRAPRVRKMLSFS+ Sbjct: 1027 VKESAIDVPTNLEARRRITFFSNSLFMDMPRAPRVRKMLSFSV 1069 >ref|XP_020418283.1| callose synthase 5 [Prunus persica] Length = 1918 Score = 79.7 bits (195), Expect = 2e-13 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -3 Query: 713 VKESVVDVPTNLEARRRITFFTNSLFMDTPRAPRVRKMLSFSL 585 VKES +DVPTNLEARRRI FFTNSLFMD PRAPRVRKMLSFS+ Sbjct: 1030 VKESAIDVPTNLEARRRIAFFTNSLFMDMPRAPRVRKMLSFSI 1072 >ref|XP_009374206.1| PREDICTED: callose synthase 5 [Pyrus x bretschneideri] Length = 1922 Score = 79.7 bits (195), Expect = 2e-13 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -3 Query: 713 VKESVVDVPTNLEARRRITFFTNSLFMDTPRAPRVRKMLSFSL 585 VKES +DVPTNLEARRRI FFTNSLFMD PRAPRVRKMLSFS+ Sbjct: 1033 VKESAIDVPTNLEARRRIAFFTNSLFMDMPRAPRVRKMLSFSI 1075 >ref|XP_008342870.1| PREDICTED: callose synthase 5-like [Malus domestica] ref|XP_008342871.1| PREDICTED: callose synthase 5-like [Malus domestica] Length = 1922 Score = 79.7 bits (195), Expect = 2e-13 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -3 Query: 713 VKESVVDVPTNLEARRRITFFTNSLFMDTPRAPRVRKMLSFSL 585 VKES +DVPTNLEARRRI FFTNSLFMD PRAPRVRKMLSFS+ Sbjct: 1033 VKESAIDVPTNLEARRRIAFFTNSLFMDMPRAPRVRKMLSFSI 1075 >ref|XP_024038938.1| LOW QUALITY PROTEIN: callose synthase 5 [Citrus clementina] Length = 1960 Score = 79.7 bits (195), Expect = 2e-13 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 713 VKESVVDVPTNLEARRRITFFTNSLFMDTPRAPRVRKMLSFSL 585 VKES +DVPTNLEARRRITFF+NSLFMD PRAPRVRKMLSFS+ Sbjct: 1059 VKESAIDVPTNLEARRRITFFSNSLFMDMPRAPRVRKMLSFSV 1101 >gb|ONK59562.1| uncharacterized protein A4U43_C08F7740 [Asparagus officinalis] Length = 1789 Score = 79.3 bits (194), Expect = 3e-13 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 713 VKESVVDVPTNLEARRRITFFTNSLFMDTPRAPRVRKMLSFSL 585 VKES +DVPTNLEARRRITFFTNSLFM+ PRAPRVRKMLSFS+ Sbjct: 900 VKESAIDVPTNLEARRRITFFTNSLFMNMPRAPRVRKMLSFSV 942