BLASTX nr result
ID: Ophiopogon22_contig00009142
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00009142 (410 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020246174.1| uncharacterized protein LOC109824065 [Aspara... 50 1e-07 ref|XP_009403555.1| PREDICTED: uncharacterized protein LOC103987... 49 9e-06 >ref|XP_020246174.1| uncharacterized protein LOC109824065 [Asparagus officinalis] Length = 222 Score = 50.1 bits (118), Expect(2) = 1e-07 Identities = 28/57 (49%), Positives = 34/57 (59%), Gaps = 11/57 (19%) Frame = -1 Query: 215 RSRTNPQISSDCGGD-----------LRHLYSPDQKAKRGIHMVQEVKILAKKVDQG 78 R RT + D G D +RHLYSPD KA GIH+VQEVK+LA+K D+G Sbjct: 15 RRRTVKRFVEDFGSDDGPGRDAVDEAIRHLYSPDLKAGWGIHVVQEVKLLARKEDRG 71 Score = 33.1 bits (74), Expect(2) = 1e-07 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = -3 Query: 102 SRKESGSGGLDLVIQELTDLGIQR 31 +RKE GGLD+ IQEL DLGIQR Sbjct: 65 ARKED-RGGLDVAIQELVDLGIQR 87 >ref|XP_009403555.1| PREDICTED: uncharacterized protein LOC103987087 [Musa acuminata subsp. malaccensis] Length = 337 Score = 48.5 bits (114), Expect(2) = 9e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -1 Query: 170 LRHLYSPDQKAKRGIHMVQEVKILAKKVDQ 81 +RHLYSPD KA GIH+VQEVK+LAKK D+ Sbjct: 142 IRHLYSPDLKAGWGIHVVQEVKLLAKKADR 171 Score = 28.5 bits (62), Expect(2) = 9e-06 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -3 Query: 96 KESGSGGLDLVIQELTDLGIQR 31 K++ GLD IQEL DLG+QR Sbjct: 167 KKADREGLDASIQELVDLGLQR 188