BLASTX nr result
ID: Ophiopogon22_contig00009074
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00009074 (368 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020248898.1| probable plastid-lipid-associated protein 12... 65 7e-10 ref|XP_009410383.2| PREDICTED: probable plastid-lipid-associated... 54 5e-06 >ref|XP_020248898.1| probable plastid-lipid-associated protein 12, chloroplastic [Asparagus officinalis] ref|XP_020248899.1| probable plastid-lipid-associated protein 12, chloroplastic [Asparagus officinalis] ref|XP_020248900.1| probable plastid-lipid-associated protein 12, chloroplastic [Asparagus officinalis] gb|ONK57236.1| uncharacterized protein A4U43_C10F18000 [Asparagus officinalis] Length = 402 Score = 65.5 bits (158), Expect = 7e-10 Identities = 31/53 (58%), Positives = 43/53 (81%) Frame = -2 Query: 364 NIYNVSLGSKGYALVGGFKLAVEIKSKYTLELLYIDNKIGIVRSNKDIMFVHL 206 N Y+VS+ S GYALVGG + E+KS+YT++LLY+DNKI I+R +K I+FV+L Sbjct: 343 NTYSVSVDS-GYALVGGLRFPAEVKSEYTMQLLYVDNKIRIMRGDKGIIFVYL 394 >ref|XP_009410383.2| PREDICTED: probable plastid-lipid-associated protein 12, chloroplastic [Musa acuminata subsp. malaccensis] Length = 424 Score = 54.3 bits (129), Expect = 5e-06 Identities = 29/58 (50%), Positives = 38/58 (65%) Frame = -2 Query: 367 SNIYNVSLGSKGYALVGGFKLAVEIKSKYTLELLYIDNKIGIVRSNKDIMFVHLHVGR 194 SN++ V + G G KL ++++ + LELLYIDNKI I RSNKD+ VHLHV R Sbjct: 366 SNLFMVQMND-GVVSFGALKLPLKMEVIFHLELLYIDNKIRISRSNKDMTLVHLHVTR 422