BLASTX nr result
ID: Ophiopogon22_contig00008918
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00008918 (891 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OIT35226.1| hypothetical protein A4A49_28326 [Nicotiana atten... 61 1e-06 gb|OIS97634.1| hypothetical protein A4A49_03982 [Nicotiana atten... 59 3e-06 gb|OIS95652.1| hypothetical protein A4A49_17679 [Nicotiana atten... 57 7e-06 >gb|OIT35226.1| hypothetical protein A4A49_28326 [Nicotiana attenuata] Length = 587 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = -2 Query: 872 QLDRVVLPSKLWIGVDDGCWQPIKYEKLPHYCVNCYTQGHSEDMCRENVRRE 717 +LD++ L K G DDG W I+YEK+P YCV C QGH E CR N+R E Sbjct: 173 RLDQIWLGYKRLDGTDDGKWLDIEYEKVPSYCVYCKMQGHCESQCRNNIRDE 224 >gb|OIS97634.1| hypothetical protein A4A49_03982 [Nicotiana attenuata] Length = 334 Score = 58.9 bits (141), Expect = 3e-06 Identities = 27/63 (42%), Positives = 38/63 (60%) Frame = -2 Query: 872 QLDRVVLPSKLWIGVDDGCWQPIKYEKLPHYCVNCYTQGHSEDMCRENVRRESPIVEQVE 693 +LD++ L K G DDG W I+YEK+P YC+ C QGH E CR +R E +++ E Sbjct: 220 KLDQIWLGYKRLDGSDDGKWLDIEYEKVPSYCLYCKMQGHLESQCRNKIRAERIKLQREE 279 Query: 692 ATR 684 T+ Sbjct: 280 QTK 282 >gb|OIS95652.1| hypothetical protein A4A49_17679 [Nicotiana attenuata] Length = 259 Score = 57.4 bits (137), Expect = 7e-06 Identities = 26/60 (43%), Positives = 36/60 (60%) Frame = -2 Query: 872 QLDRVVLPSKLWIGVDDGCWQPIKYEKLPHYCVNCYTQGHSEDMCRENVRRESPIVEQVE 693 +LD++ L L G +DG W I+YEK+P YC+ C QGH E CR +R E V++ E Sbjct: 172 RLDQIWLGFNLLDGTEDGRWLEIEYEKVPSYCLYCKLQGHLESQCRNKIRDERVKVQREE 231