BLASTX nr result
ID: Ophiopogon22_contig00008487
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00008487 (364 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK65020.1| tRNA wybutosine-synthesizing protein 5 [Asparagus... 59 9e-08 ref|XP_020273032.1| uncharacterized protein LOC109848110 isoform... 59 9e-08 >gb|ONK65020.1| tRNA wybutosine-synthesizing protein 5 [Asparagus officinalis] Length = 520 Score = 59.3 bits (142), Expect = 9e-08 Identities = 31/53 (58%), Positives = 38/53 (71%), Gaps = 1/53 (1%) Frame = +3 Query: 3 CHEFDSNSHMVNVSGN-SNHWPTF*ELEPFALSMLYELISLVHDAIKVGGKNE 158 C EF+SN M NV+ N + +LEPFAL MLYELISLVH+ +KVGG+NE Sbjct: 348 CSEFNSNIRMENVNENDTKQGLDLQQLEPFALRMLYELISLVHNVLKVGGRNE 400 >ref|XP_020273032.1| uncharacterized protein LOC109848110 isoform X2 [Asparagus officinalis] Length = 541 Score = 59.3 bits (142), Expect = 9e-08 Identities = 31/53 (58%), Positives = 38/53 (71%), Gaps = 1/53 (1%) Frame = +3 Query: 3 CHEFDSNSHMVNVSGN-SNHWPTF*ELEPFALSMLYELISLVHDAIKVGGKNE 158 C EF+SN M NV+ N + +LEPFAL MLYELISLVH+ +KVGG+NE Sbjct: 348 CSEFNSNIRMENVNENDTKQGLDLQQLEPFALRMLYELISLVHNVLKVGGRNE 400