BLASTX nr result
ID: Ophiopogon22_contig00008409
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00008409 (467 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023905458.1| probable choline kinase 2 isoform X2 [Quercu... 65 2e-09 gb|POF19707.1| putative choline kinase 2 [Quercus suber] 65 2e-09 gb|POF19708.1| putative choline kinase 2 [Quercus suber] 65 2e-09 ref|XP_023905457.1| probable choline kinase 2 isoform X1 [Quercu... 65 2e-09 dbj|GAV90953.1| hypothetical protein CFOL_v3_34353 [Cephalotus f... 62 3e-09 gb|POF12012.1| putative choline kinase 2 [Quercus suber] 62 4e-09 gb|OVA10613.1| Choline kinase [Macleaya cordata] 64 6e-09 gb|EEF36801.1| choline/ethanolamine kinase, putative [Ricinus co... 63 1e-08 ref|XP_015578741.1| PREDICTED: probable choline kinase 2 isoform... 63 1e-08 ref|XP_011020457.1| PREDICTED: probable choline kinase 2 isoform... 63 1e-08 ref|XP_011020456.1| PREDICTED: probable choline kinase 2 isoform... 63 1e-08 ref|XP_011020455.1| PREDICTED: probable choline kinase 2 isoform... 63 1e-08 gb|ABK94958.1| unknown [Populus trichocarpa] 63 1e-08 ref|XP_008365827.1| PREDICTED: probable choline kinase 1 [Malus ... 59 1e-08 ref|XP_011020454.1| PREDICTED: probable choline kinase 2 isoform... 63 2e-08 ref|XP_020098014.1| probable choline kinase 2 [Ananas comosus] 62 2e-08 gb|OAY85526.1| putative choline kinase 2 [Ananas comosus] 62 2e-08 ref|XP_008786565.1| PREDICTED: probable choline kinase 2 [Phoeni... 62 4e-08 ref|XP_008346982.1| PREDICTED: probable choline kinase 2 [Malus ... 59 5e-08 ref|XP_009408828.1| PREDICTED: probable choline kinase 2 [Musa a... 61 5e-08 >ref|XP_023905458.1| probable choline kinase 2 isoform X2 [Quercus suber] Length = 357 Score = 65.5 bits (158), Expect = 2e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 264 EHVNEFDFDYMDYARQRFQQYWLRKPVILGTELGS 160 EHVNE DFDYM+YARQRFQQYWLRKP +LG+ GS Sbjct: 312 EHVNEIDFDYMEYARQRFQQYWLRKPELLGSVRGS 346 >gb|POF19707.1| putative choline kinase 2 [Quercus suber] Length = 390 Score = 65.5 bits (158), Expect = 2e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 264 EHVNEFDFDYMDYARQRFQQYWLRKPVILGTELGS 160 EHVNE DFDYM+YARQRFQQYWLRKP +LG+ GS Sbjct: 345 EHVNEIDFDYMEYARQRFQQYWLRKPELLGSVRGS 379 >gb|POF19708.1| putative choline kinase 2 [Quercus suber] Length = 400 Score = 65.5 bits (158), Expect = 2e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 264 EHVNEFDFDYMDYARQRFQQYWLRKPVILGTELGS 160 EHVNE DFDYM+YARQRFQQYWLRKP +LG+ GS Sbjct: 355 EHVNEIDFDYMEYARQRFQQYWLRKPELLGSVRGS 389 >ref|XP_023905457.1| probable choline kinase 2 isoform X1 [Quercus suber] Length = 433 Score = 65.5 bits (158), Expect = 2e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 264 EHVNEFDFDYMDYARQRFQQYWLRKPVILGTELGS 160 EHVNE DFDYM+YARQRFQQYWLRKP +LG+ GS Sbjct: 388 EHVNEIDFDYMEYARQRFQQYWLRKPELLGSVRGS 422 >dbj|GAV90953.1| hypothetical protein CFOL_v3_34353 [Cephalotus follicularis] Length = 122 Score = 61.6 bits (148), Expect = 3e-09 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 264 EHVNEFDFDYMDYARQRFQQYWLRKPVILGT 172 EHVNE DFDY++YARQRFQQYWLRKP +LG+ Sbjct: 50 EHVNEIDFDYIEYARQRFQQYWLRKPELLGS 80 >gb|POF12012.1| putative choline kinase 2 [Quercus suber] Length = 159 Score = 62.0 bits (149), Expect = 4e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 264 EHVNEFDFDYMDYARQRFQQYWLRKPVILGTEL 166 EHVNE DFDYM+YARQRFQQYWLRKP +L E+ Sbjct: 102 EHVNEIDFDYMEYARQRFQQYWLRKPELLEMEM 134 >gb|OVA10613.1| Choline kinase [Macleaya cordata] Length = 360 Score = 63.9 bits (154), Expect = 6e-09 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -3 Query: 264 EHVNEFDFDYMDYARQRFQQYWLRKPVILGTELG 163 EHVNE DFDY +YARQRF+QYWLRKP++LG++ G Sbjct: 314 EHVNEIDFDYKEYARQRFEQYWLRKPILLGSDRG 347 >gb|EEF36801.1| choline/ethanolamine kinase, putative [Ricinus communis] Length = 332 Score = 62.8 bits (151), Expect = 1e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -3 Query: 264 EHVNEFDFDYMDYARQRFQQYWLRKPVILGTELGS 160 EHVNE DFDYM+YARQRF+QYWLRKP +LG+ LGS Sbjct: 297 EHVNEIDFDYMEYARQRFEQYWLRKPELLGS-LGS 330 >ref|XP_015578741.1| PREDICTED: probable choline kinase 2 isoform X1 [Ricinus communis] ref|XP_015578742.1| PREDICTED: probable choline kinase 2 isoform X1 [Ricinus communis] ref|XP_015578743.1| PREDICTED: probable choline kinase 2 isoform X2 [Ricinus communis] Length = 348 Score = 62.8 bits (151), Expect = 1e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -3 Query: 264 EHVNEFDFDYMDYARQRFQQYWLRKPVILGTELGS 160 EHVNE DFDYM+YARQRF+QYWLRKP +LG+ LGS Sbjct: 313 EHVNEIDFDYMEYARQRFEQYWLRKPELLGS-LGS 346 >ref|XP_011020457.1| PREDICTED: probable choline kinase 2 isoform X4 [Populus euphratica] Length = 355 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 264 EHVNEFDFDYMDYARQRFQQYWLRKPVILGT 172 EHVNE DFDYM+YARQRF+QYWLRKP +LG+ Sbjct: 313 EHVNEIDFDYMEYARQRFEQYWLRKPALLGS 343 >ref|XP_011020456.1| PREDICTED: probable choline kinase 2 isoform X3 [Populus euphratica] Length = 355 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 264 EHVNEFDFDYMDYARQRFQQYWLRKPVILGT 172 EHVNE DFDYM+YARQRF+QYWLRKP +LG+ Sbjct: 313 EHVNEIDFDYMEYARQRFEQYWLRKPALLGS 343 >ref|XP_011020455.1| PREDICTED: probable choline kinase 2 isoform X2 [Populus euphratica] Length = 359 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 264 EHVNEFDFDYMDYARQRFQQYWLRKPVILGT 172 EHVNE DFDYM+YARQRF+QYWLRKP +LG+ Sbjct: 313 EHVNEIDFDYMEYARQRFEQYWLRKPALLGS 343 >gb|ABK94958.1| unknown [Populus trichocarpa] Length = 359 Score = 62.8 bits (151), Expect = 1e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 264 EHVNEFDFDYMDYARQRFQQYWLRKPVILGT 172 EHVNE DFDYM+YARQRF+QYWLRKP +LG+ Sbjct: 313 EHVNEIDFDYMEYARQRFEQYWLRKPALLGS 343 >ref|XP_008365827.1| PREDICTED: probable choline kinase 1 [Malus domestica] Length = 105 Score = 59.3 bits (142), Expect = 1e-08 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -3 Query: 261 HVNEFDFDYMDYARQRFQQYWLRKPVILGTELGSL 157 HVN+ DFDY +YARQRFQQYWLRKP +LG+ SL Sbjct: 71 HVNKIDFDYTEYARQRFQQYWLRKPALLGSSGDSL 105 >ref|XP_011020454.1| PREDICTED: probable choline kinase 2 isoform X1 [Populus euphratica] Length = 383 Score = 62.8 bits (151), Expect = 2e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 264 EHVNEFDFDYMDYARQRFQQYWLRKPVILGT 172 EHVNE DFDYM+YARQRF+QYWLRKP +LG+ Sbjct: 313 EHVNEIDFDYMEYARQRFEQYWLRKPALLGS 343 >ref|XP_020098014.1| probable choline kinase 2 [Ananas comosus] Length = 354 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 264 EHVNEFDFDYMDYARQRFQQYWLRKPVILGTE 169 EHVNE DFDY++YARQRFQQYWL+KPVI G++ Sbjct: 323 EHVNEIDFDYVEYARQRFQQYWLKKPVIFGSK 354 >gb|OAY85526.1| putative choline kinase 2 [Ananas comosus] Length = 354 Score = 62.4 bits (150), Expect = 2e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 264 EHVNEFDFDYMDYARQRFQQYWLRKPVILGTE 169 EHVNE DFDY++YARQRFQQYWL+KPVI G++ Sbjct: 323 EHVNEIDFDYVEYARQRFQQYWLKKPVIFGSK 354 >ref|XP_008786565.1| PREDICTED: probable choline kinase 2 [Phoenix dactylifera] Length = 347 Score = 61.6 bits (148), Expect = 4e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 264 EHVNEFDFDYMDYARQRFQQYWLRKPVILGT 172 EHVN+ +FDYM+YARQRFQQYWLRKP LGT Sbjct: 316 EHVNDIEFDYMEYARQRFQQYWLRKPAALGT 346 >ref|XP_008346982.1| PREDICTED: probable choline kinase 2 [Malus domestica] Length = 141 Score = 58.9 bits (141), Expect = 5e-08 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -3 Query: 264 EHVNEFDFDYMDYARQRFQQYWLRKPVILGT 172 EHVNE DFDYM+YARQRFQQYW+ +P +LG+ Sbjct: 70 EHVNEIDFDYMEYARQRFQQYWISRPKLLGS 100 >ref|XP_009408828.1| PREDICTED: probable choline kinase 2 [Musa acuminata subsp. malaccensis] ref|XP_018684166.1| PREDICTED: probable choline kinase 2 [Musa acuminata subsp. malaccensis] Length = 347 Score = 61.2 bits (147), Expect = 5e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 264 EHVNEFDFDYMDYARQRFQQYWLRKPVILGTE 169 EHVNE DF+YM+YARQRFQQYWL KP +LG+E Sbjct: 316 EHVNEIDFEYMEYARQRFQQYWLMKPKLLGSE 347