BLASTX nr result
ID: Ophiopogon22_contig00008391
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00008391 (424 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNT47974.1| hypothetical protein POPTR_002G054800v3 [Populus ... 81 3e-17 ref|XP_002302121.1| small nuclear ribonucleoprotein D1 [Populus ... 81 4e-17 ref|XP_019164535.1| PREDICTED: small nuclear ribonucleoprotein S... 80 8e-17 ref|XP_018715524.1| PREDICTED: small nuclear ribonucleoprotein S... 80 1e-16 ref|XP_022035155.1| small nuclear ribonucleoprotein SmD1a-like [... 80 1e-16 ref|XP_010070238.1| PREDICTED: small nuclear ribonucleoprotein S... 80 1e-16 ref|XP_004290666.1| PREDICTED: small nuclear ribonucleoprotein S... 80 1e-16 ref|XP_010038105.1| PREDICTED: small nuclear ribonucleoprotein S... 80 2e-16 emb|CAN80377.1| hypothetical protein VITISV_038700 [Vitis vinifera] 79 2e-16 ref|XP_011079833.1| small nuclear ribonucleoprotein Sm D1-like i... 79 2e-16 ref|XP_008803650.1| PREDICTED: small nuclear ribonucleoprotein S... 79 2e-16 ref|XP_020109850.1| small nuclear ribonucleoprotein Sm D1-like [... 79 2e-16 ref|XP_016696096.1| PREDICTED: small nuclear ribonucleoprotein S... 79 2e-16 ref|XP_011079832.1| small nuclear ribonucleoprotein Sm D1-like i... 79 2e-16 ref|XP_009415551.1| PREDICTED: small nuclear ribonucleoprotein S... 79 2e-16 ref|XP_002520764.1| PREDICTED: small nuclear ribonucleoprotein S... 79 2e-16 ref|XP_006857628.1| small nuclear ribonucleoprotein Sm D1 [Ambor... 79 2e-16 ref|XP_004150106.1| PREDICTED: small nuclear ribonucleoprotein S... 79 2e-16 ref|XP_023886597.1| small nuclear ribonucleoprotein SmD1b [Querc... 79 2e-16 gb|EPS67294.1| hypothetical protein M569_07483, partial [Genlise... 79 2e-16 >gb|PNT47974.1| hypothetical protein POPTR_002G054800v3 [Populus trichocarpa] Length = 108 Score = 81.3 bits (199), Expect = 3e-17 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 422 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL 306 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL Sbjct: 53 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL 91 >ref|XP_002302121.1| small nuclear ribonucleoprotein D1 [Populus trichocarpa] gb|ABK93236.1| unknown [Populus trichocarpa] gb|ABK96200.1| unknown [Populus trichocarpa] gb|PNT47975.1| hypothetical protein POPTR_002G054800v3 [Populus trichocarpa] Length = 115 Score = 81.3 bits (199), Expect = 4e-17 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 422 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL 306 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL Sbjct: 60 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL 98 >ref|XP_019164535.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Ipomoea nil] ref|XP_019197450.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Ipomoea nil] Length = 114 Score = 80.5 bits (197), Expect = 8e-17 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -3 Query: 422 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL 306 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRA+ Sbjct: 60 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAM 98 >ref|XP_018715524.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like isoform X2 [Eucalyptus grandis] Length = 110 Score = 80.1 bits (196), Expect = 1e-16 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -3 Query: 422 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL 306 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRA+ Sbjct: 56 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAV 94 >ref|XP_022035155.1| small nuclear ribonucleoprotein SmD1a-like [Helianthus annuus] gb|OTG28735.1| putative LSM domain, Like-Sm (LSM) domain containing protein, LSm4/SmD1/SmD3 [Helianthus annuus] Length = 114 Score = 80.1 bits (196), Expect = 1e-16 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -3 Query: 422 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL 306 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRA+ Sbjct: 60 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAV 98 >ref|XP_010070238.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like isoform X1 [Eucalyptus grandis] ref|XP_018715522.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like isoform X1 [Eucalyptus grandis] ref|XP_018715523.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like isoform X1 [Eucalyptus grandis] Length = 114 Score = 80.1 bits (196), Expect = 1e-16 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -3 Query: 422 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL 306 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRA+ Sbjct: 60 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAV 98 >ref|XP_004290666.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Fragaria vesca subsp. vesca] Length = 115 Score = 80.1 bits (196), Expect = 1e-16 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -3 Query: 422 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL 306 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRA+ Sbjct: 60 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAV 98 >ref|XP_010038105.1| PREDICTED: small nuclear ribonucleoprotein Sm D1 [Eucalyptus grandis] gb|KCW49912.1| hypothetical protein EUGRSUZ_K03379 [Eucalyptus grandis] Length = 114 Score = 79.7 bits (195), Expect = 2e-16 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -3 Query: 422 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL 306 VRGNNIRYYILPDS+NLETLLVEETPRVKPKKPTAGRA+ Sbjct: 60 VRGNNIRYYILPDSINLETLLVEETPRVKPKKPTAGRAM 98 >emb|CAN80377.1| hypothetical protein VITISV_038700 [Vitis vinifera] Length = 79 Score = 78.6 bits (192), Expect = 2e-16 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -3 Query: 422 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL 306 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGR + Sbjct: 25 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRPM 63 >ref|XP_011079833.1| small nuclear ribonucleoprotein Sm D1-like isoform X2 [Sesamum indicum] Length = 107 Score = 79.3 bits (194), Expect = 2e-16 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -3 Query: 422 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL 306 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGR L Sbjct: 53 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRPL 91 >ref|XP_008803650.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Phoenix dactylifera] Length = 107 Score = 79.3 bits (194), Expect = 2e-16 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -3 Query: 422 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL 306 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGR L Sbjct: 53 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRPL 91 >ref|XP_020109850.1| small nuclear ribonucleoprotein Sm D1-like [Ananas comosus] Length = 114 Score = 79.3 bits (194), Expect = 2e-16 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -3 Query: 422 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL 306 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGR L Sbjct: 60 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRPL 98 >ref|XP_016696096.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Gossypium hirsutum] ref|XP_007050651.2| PREDICTED: small nuclear ribonucleoprotein Sm D1 [Theobroma cacao] ref|XP_021280453.1| small nuclear ribonucleoprotein Sm D1-like [Herrania umbratica] ref|XP_022758198.1| small nuclear ribonucleoprotein SmD1a [Durio zibethinus] ref|XP_022727803.1| small nuclear ribonucleoprotein SmD1a [Durio zibethinus] Length = 114 Score = 79.3 bits (194), Expect = 2e-16 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -3 Query: 422 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL 306 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGR L Sbjct: 60 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRPL 98 >ref|XP_011079832.1| small nuclear ribonucleoprotein Sm D1-like isoform X1 [Sesamum indicum] Length = 114 Score = 79.3 bits (194), Expect = 2e-16 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -3 Query: 422 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL 306 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGR L Sbjct: 60 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRPL 98 >ref|XP_009415551.1| PREDICTED: small nuclear ribonucleoprotein Sm D1 [Musa acuminata subsp. malaccensis] Length = 114 Score = 79.3 bits (194), Expect = 2e-16 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -3 Query: 422 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL 306 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGR++ Sbjct: 60 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRSM 98 >ref|XP_002520764.1| PREDICTED: small nuclear ribonucleoprotein Sm D1 [Ricinus communis] ref|XP_010928024.1| PREDICTED: small nuclear ribonucleoprotein Sm D1 [Elaeis guineensis] ref|XP_020268044.1| small nuclear ribonucleoprotein Sm D1-like [Asparagus officinalis] gb|EEF41726.1| small nuclear ribonucleoprotein sm d1, putative [Ricinus communis] gb|ONK68092.1| uncharacterized protein A4U43_C05F7360 [Asparagus officinalis] Length = 114 Score = 79.3 bits (194), Expect = 2e-16 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -3 Query: 422 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL 306 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGR L Sbjct: 60 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRPL 98 >ref|XP_006857628.1| small nuclear ribonucleoprotein Sm D1 [Amborella trichopoda] ref|XP_010912191.1| PREDICTED: small nuclear ribonucleoprotein Sm D1 [Elaeis guineensis] ref|XP_020274160.1| small nuclear ribonucleoprotein Sm D1-like [Asparagus officinalis] ref|XP_021608055.1| small nuclear ribonucleoprotein SmD1a [Manihot esculenta] ref|XP_021681327.1| small nuclear ribonucleoprotein SmD1a [Hevea brasiliensis] ref|XP_021645348.1| small nuclear ribonucleoprotein SmD1a [Hevea brasiliensis] ref|XP_021898018.1| small nuclear ribonucleoprotein SmD1a isoform X2 [Carica papaya] gb|ERN19095.1| hypothetical protein AMTR_s00061p00127560 [Amborella trichopoda] gb|OAY61685.1| hypothetical protein MANES_01G208900 [Manihot esculenta] gb|ONK79313.1| uncharacterized protein A4U43_C01F5100 [Asparagus officinalis] gb|PON86135.1| Like-Sm (LSM) domain containing protein [Trema orientalis] Length = 114 Score = 79.3 bits (194), Expect = 2e-16 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -3 Query: 422 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL 306 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGR L Sbjct: 60 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRPL 98 >ref|XP_004150106.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Cucumis sativus] ref|XP_008454659.1| PREDICTED: small nuclear ribonucleoprotein Sm D1-like [Cucumis melo] ref|XP_022155676.1| small nuclear ribonucleoprotein SmD1b [Momordica charantia] ref|XP_022157762.1| small nuclear ribonucleoprotein SmD1b [Momordica charantia] ref|XP_022157763.1| small nuclear ribonucleoprotein SmD1b [Momordica charantia] gb|KGN59890.1| hypothetical protein Csa_3G851900 [Cucumis sativus] Length = 114 Score = 79.3 bits (194), Expect = 2e-16 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -3 Query: 422 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL 306 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGR L Sbjct: 60 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRPL 98 >ref|XP_023886597.1| small nuclear ribonucleoprotein SmD1b [Quercus suber] Length = 115 Score = 79.3 bits (194), Expect = 2e-16 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -3 Query: 422 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL 306 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGR L Sbjct: 60 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRPL 98 >gb|EPS67294.1| hypothetical protein M569_07483, partial [Genlisea aurea] Length = 116 Score = 79.3 bits (194), Expect = 2e-16 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -3 Query: 422 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRAL 306 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGR L Sbjct: 62 VRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRPL 100