BLASTX nr result
ID: Ophiopogon22_contig00008294
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00008294 (670 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020241752.1| cullin-1-like [Asparagus officinalis] >gi|11... 68 2e-09 gb|AQK42183.1| Cullin-1 [Zea mays] >gi|1142647214|gb|AQK42200.1|... 66 2e-09 gb|PNY00650.1| cullin-1-like protein [Trifolium pratense] 61 3e-09 gb|AQK95107.1| Cullin-1 [Zea mays] 66 4e-09 ref|XP_021803852.1| cullin-1-like [Prunus avium] 62 4e-09 gb|AEZ00848.1| putative cullin protein, partial [Elaeis guineensis] 62 4e-09 gb|PKI41797.1| hypothetical protein CRG98_037797 [Punica granatum] 62 4e-09 ref|XP_018723641.1| PREDICTED: cullin-1-like [Eucalyptus grandis] 62 4e-09 gb|KQL13048.1| hypothetical protein SETIT_021373mg [Setaria ital... 67 4e-09 ref|XP_022680734.1| cullin-1, partial [Setaria italica] 67 4e-09 gb|PAN17290.1| hypothetical protein PAHAL_C01360 [Panicum hallii] 67 4e-09 gb|OEL14049.1| Cullin-1 [Dichanthelium oligosanthes] 67 4e-09 ref|XP_002440598.1| cullin-1 [Sorghum bicolor] >gi|241945883|gb|... 67 4e-09 gb|AQK95108.1| Cullin-1 [Zea mays] 66 5e-09 gb|AQK42182.1| Cullin-1 [Zea mays] >gi|1142647217|gb|AQK42203.1|... 66 5e-09 gb|AQK42186.1| Cullin-1 [Zea mays] >gi|1142647213|gb|AQK42199.1|... 66 5e-09 gb|AQK95111.1| Cullin-1 [Zea mays] 66 5e-09 dbj|BAS92287.1| Os05g0149600, partial [Oryza sativa Japonica Group] 65 6e-09 gb|AQK95118.1| Cullin-1 [Zea mays] >gi|1142837034|gb|AQK95120.1|... 66 6e-09 gb|AQK42188.1| Cullin-1 [Zea mays] 66 6e-09 >ref|XP_020241752.1| cullin-1-like [Asparagus officinalis] gb|ONK61571.1| uncharacterized protein A4U43_C08F31360 [Asparagus officinalis] Length = 744 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 230 PDFKAFKKRIEDLITRDYLERDKDNANVYKYLS 132 PDFKA KKRIEDLITRDYLERDKDNANVYKYL+ Sbjct: 712 PDFKAIKKRIEDLITRDYLERDKDNANVYKYLA 744 >gb|AQK42183.1| Cullin-1 [Zea mays] gb|AQK42200.1| Cullin-1 [Zea mays] Length = 268 Score = 66.2 bits (160), Expect = 2e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 230 PDFKAFKKRIEDLITRDYLERDKDNANVYKYLS 132 PDFKA KKRIEDLITRDYLERDKDNAN YKYL+ Sbjct: 236 PDFKAIKKRIEDLITRDYLERDKDNANTYKYLA 268 >gb|PNY00650.1| cullin-1-like protein [Trifolium pratense] Length = 36 Score = 60.8 bits (146), Expect = 3e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 230 PDFKAFKKRIEDLITRDYLERDKDNANVYKYLS 132 PD KA KKRIEDLI+RDYLERDKDNAN++KYL+ Sbjct: 4 PDVKAIKKRIEDLISRDYLERDKDNANLFKYLA 36 >gb|AQK95107.1| Cullin-1 [Zea mays] Length = 320 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 230 PDFKAFKKRIEDLITRDYLERDKDNANVYKYLS 132 PDFKA KKRIEDLITRDYLERDKDNAN YKYL+ Sbjct: 288 PDFKAIKKRIEDLITRDYLERDKDNANTYKYLA 320 >ref|XP_021803852.1| cullin-1-like [Prunus avium] Length = 91 Score = 62.0 bits (149), Expect = 4e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 230 PDFKAFKKRIEDLITRDYLERDKDNANVYKYLS 132 PDFKA KKRIEDLITRDYLERDKDN N+++YL+ Sbjct: 59 PDFKAIKKRIEDLITRDYLERDKDNPNLFRYLA 91 >gb|AEZ00848.1| putative cullin protein, partial [Elaeis guineensis] Length = 91 Score = 62.0 bits (149), Expect = 4e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 230 PDFKAFKKRIEDLITRDYLERDKDNANVYKYLS 132 PDFKA KKRIEDLITRDYLERDKDN N+++YL+ Sbjct: 59 PDFKAIKKRIEDLITRDYLERDKDNPNLFRYLA 91 >gb|PKI41797.1| hypothetical protein CRG98_037797 [Punica granatum] Length = 94 Score = 62.0 bits (149), Expect = 4e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 230 PDFKAFKKRIEDLITRDYLERDKDNANVYKYLS 132 PDFKA KKRIEDLITRDYLERDKDN N+++YL+ Sbjct: 62 PDFKAIKKRIEDLITRDYLERDKDNPNLFRYLA 94 >ref|XP_018723641.1| PREDICTED: cullin-1-like [Eucalyptus grandis] Length = 94 Score = 62.0 bits (149), Expect = 4e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 230 PDFKAFKKRIEDLITRDYLERDKDNANVYKYLS 132 PDFKA KKRIEDLITRDYLERDKDN N+++YL+ Sbjct: 62 PDFKAIKKRIEDLITRDYLERDKDNPNLFRYLA 94 >gb|KQL13048.1| hypothetical protein SETIT_021373mg [Setaria italica] Length = 693 Score = 66.6 bits (161), Expect = 4e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 230 PDFKAFKKRIEDLITRDYLERDKDNANVYKYLS 132 PDFKA KKRIEDLITRDYLERDKDNAN+YKYL+ Sbjct: 661 PDFKAIKKRIEDLITRDYLERDKDNANMYKYLA 693 >ref|XP_022680734.1| cullin-1, partial [Setaria italica] Length = 727 Score = 66.6 bits (161), Expect = 4e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 230 PDFKAFKKRIEDLITRDYLERDKDNANVYKYLS 132 PDFKA KKRIEDLITRDYLERDKDNAN+YKYL+ Sbjct: 695 PDFKAIKKRIEDLITRDYLERDKDNANMYKYLA 727 >gb|PAN17290.1| hypothetical protein PAHAL_C01360 [Panicum hallii] Length = 744 Score = 66.6 bits (161), Expect = 4e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 230 PDFKAFKKRIEDLITRDYLERDKDNANVYKYLS 132 PDFKA KKRIEDLITRDYLERDKDNAN+YKYL+ Sbjct: 712 PDFKAIKKRIEDLITRDYLERDKDNANMYKYLA 744 >gb|OEL14049.1| Cullin-1 [Dichanthelium oligosanthes] Length = 744 Score = 66.6 bits (161), Expect = 4e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 230 PDFKAFKKRIEDLITRDYLERDKDNANVYKYLS 132 PDFKA KKRIEDLITRDYLERDKDNAN+YKYL+ Sbjct: 712 PDFKAIKKRIEDLITRDYLERDKDNANMYKYLA 744 >ref|XP_002440598.1| cullin-1 [Sorghum bicolor] gb|EES19028.1| hypothetical protein SORBI_3009G044800 [Sorghum bicolor] Length = 744 Score = 66.6 bits (161), Expect = 4e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 230 PDFKAFKKRIEDLITRDYLERDKDNANVYKYLS 132 PDFKA KKRIEDLITRDYLERDKDNAN+YKYL+ Sbjct: 712 PDFKAIKKRIEDLITRDYLERDKDNANMYKYLA 744 >gb|AQK95108.1| Cullin-1 [Zea mays] Length = 406 Score = 66.2 bits (160), Expect = 5e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 230 PDFKAFKKRIEDLITRDYLERDKDNANVYKYLS 132 PDFKA KKRIEDLITRDYLERDKDNAN YKYL+ Sbjct: 374 PDFKAIKKRIEDLITRDYLERDKDNANTYKYLA 406 >gb|AQK42182.1| Cullin-1 [Zea mays] gb|AQK42203.1| Cullin-1 [Zea mays] gb|AQK42204.1| Cullin-1 [Zea mays] Length = 409 Score = 66.2 bits (160), Expect = 5e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 230 PDFKAFKKRIEDLITRDYLERDKDNANVYKYLS 132 PDFKA KKRIEDLITRDYLERDKDNAN YKYL+ Sbjct: 377 PDFKAIKKRIEDLITRDYLERDKDNANTYKYLA 409 >gb|AQK42186.1| Cullin-1 [Zea mays] gb|AQK42199.1| Cullin-1 [Zea mays] Length = 456 Score = 66.2 bits (160), Expect = 5e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 230 PDFKAFKKRIEDLITRDYLERDKDNANVYKYLS 132 PDFKA KKRIEDLITRDYLERDKDNAN YKYL+ Sbjct: 424 PDFKAIKKRIEDLITRDYLERDKDNANTYKYLA 456 >gb|AQK95111.1| Cullin-1 [Zea mays] Length = 521 Score = 66.2 bits (160), Expect = 5e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 230 PDFKAFKKRIEDLITRDYLERDKDNANVYKYLS 132 PDFKA KKRIEDLITRDYLERDKDNAN YKYL+ Sbjct: 489 PDFKAIKKRIEDLITRDYLERDKDNANTYKYLA 521 >dbj|BAS92287.1| Os05g0149600, partial [Oryza sativa Japonica Group] Length = 259 Score = 65.1 bits (157), Expect = 6e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 230 PDFKAFKKRIEDLITRDYLERDKDNANVYKYLS 132 PDFKA KKRIEDLITRDYLER+KDNANVY+YL+ Sbjct: 227 PDFKAIKKRIEDLITRDYLEREKDNANVYRYLA 259 >gb|AQK95118.1| Cullin-1 [Zea mays] gb|AQK95120.1| Cullin-1 [Zea mays] Length = 652 Score = 66.2 bits (160), Expect = 6e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 230 PDFKAFKKRIEDLITRDYLERDKDNANVYKYLS 132 PDFKA KKRIEDLITRDYLERDKDNAN YKYL+ Sbjct: 620 PDFKAIKKRIEDLITRDYLERDKDNANTYKYLA 652 >gb|AQK42188.1| Cullin-1 [Zea mays] Length = 652 Score = 66.2 bits (160), Expect = 6e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 230 PDFKAFKKRIEDLITRDYLERDKDNANVYKYLS 132 PDFKA KKRIEDLITRDYLERDKDNAN YKYL+ Sbjct: 620 PDFKAIKKRIEDLITRDYLERDKDNANTYKYLA 652