BLASTX nr result
ID: Ophiopogon22_contig00007477
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00007477 (357 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK68821.1| uncharacterized protein A4U43_C05F16370 [Asparagu... 54 7e-06 >gb|ONK68821.1| uncharacterized protein A4U43_C05F16370 [Asparagus officinalis] Length = 256 Score = 53.5 bits (127), Expect = 7e-06 Identities = 35/97 (36%), Positives = 52/97 (53%), Gaps = 3/97 (3%) Frame = -1 Query: 282 IFLFDPF-TWTQVSRLPSRTTIPPCPRGIVGKGYAISSHIYRLATDGSIAVAL-DLPSSR 109 I L +PF +W+Q+ LPS +T+ P + I R+A + + AVA+ L + Sbjct: 15 IHLVNPFDSWSQLGLLPSSSTLSEDP-----SKHPACRRIVRIAMNNTAAVAMWGLSRNF 69 Query: 108 LVYARVGSTDRWFDLQQAVDF-HYEDIVPYKEGLFCA 1 L Y R+G RW DL V + +ED+ YK+GLF A Sbjct: 70 LAYTRLGVDHRWIDLGDIVGYDKFEDVAAYKDGLFYA 106