BLASTX nr result
ID: Ophiopogon22_contig00007468
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00007468 (1495 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKU74568.1| hypothetical protein MA16_Dca003771 [Dendrobium c... 49 4e-10 gb|PKU66219.1| hypothetical protein MA16_Dca009593 [Dendrobium c... 44 2e-07 gb|PKU60168.1| hypothetical protein MA16_Dca028837 [Dendrobium c... 44 9e-07 >gb|PKU74568.1| hypothetical protein MA16_Dca003771 [Dendrobium catenatum] Length = 252 Score = 48.9 bits (115), Expect(2) = 4e-10 Identities = 28/65 (43%), Positives = 36/65 (55%), Gaps = 5/65 (7%) Frame = -2 Query: 1491 FKVGDCDKLHALKQDPSRCTKLM-----IMHIF*TFGVSPIFNIEDLVAYKGLDFNLSNP 1327 F G KLHA P + K + I+ + F ++P FNIEDLVAY+G DFN NP Sbjct: 64 FPPGTVKKLHAKSAGPFKILKKINDNAYIVDLPADFNINPSFNIEDLVAYEGPDFNPQNP 123 Query: 1326 LLVEP 1312 L +P Sbjct: 124 LSKQP 128 Score = 45.8 bits (107), Expect(2) = 4e-10 Identities = 24/47 (51%), Positives = 28/47 (59%) Frame = -1 Query: 1195 DGRTRRYLIHWKGKPASDDN*XXXXXXXXXXXDALKRYESNRDTYST 1055 +G RRYLI WKGKP S+D DAL+ YES RD+YST Sbjct: 167 EGGRRRYLIRWKGKPESEDTWLDREELQQIDPDALEIYESARDSYST 213 >gb|PKU66219.1| hypothetical protein MA16_Dca009593 [Dendrobium catenatum] Length = 132 Score = 44.3 bits (103), Expect(2) = 2e-07 Identities = 22/56 (39%), Positives = 30/56 (53%) Frame = -1 Query: 1195 DGRTRRYLIHWKGKPASDDN*XXXXXXXXXXXDALKRYESNRDTYSTGLSSPTRGE 1028 DG RYL+ W+GKP ++D + L+ YES++D YSTG S GE Sbjct: 67 DGGRHRYLVRWRGKPETEDTWLERDEIQRLDPNLLELYESSQDPYSTGSSFLPPGE 122 Score = 41.6 bits (96), Expect(2) = 2e-07 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -2 Query: 1395 VSPIFNIEDLVAYKGLDFNLSNPLLVEP 1312 ++P FNIEDLVA+ G DFN NPL +EP Sbjct: 1 MNPTFNIEDLVAFDGPDFNPENPLNIEP 28 >gb|PKU60168.1| hypothetical protein MA16_Dca028837 [Dendrobium catenatum] Length = 149 Score = 44.3 bits (103), Expect(2) = 9e-07 Identities = 23/56 (41%), Positives = 30/56 (53%) Frame = -1 Query: 1195 DGRTRRYLIHWKGKPASDDN*XXXXXXXXXXXDALKRYESNRDTYSTGLSSPTRGE 1028 DG RYL+ W+GKP ++D D L+ YES++D YSTG S GE Sbjct: 67 DGGRHRYLVRWRGKPETEDTWLERDEIQRLDPDILELYESSQDPYSTGSSFLPPGE 122 Score = 39.3 bits (90), Expect(2) = 9e-07 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -2 Query: 1395 VSPIFNIEDLVAYKGLDFNLSNPLLVEP 1312 ++P FNIEDLV + G DFN NPL +EP Sbjct: 1 MNPTFNIEDLVVFDGPDFNPKNPLNLEP 28