BLASTX nr result
ID: Ophiopogon22_contig00006804
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00006804 (518 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020580413.1| WD repeat-containing protein 76 [Phalaenopsi... 62 6e-08 gb|OAY71546.1| DNA damage-binding protein CMR1, partial [Ananas ... 60 8e-08 ref|XP_020251708.1| WD repeat-containing protein 76 [Asparagus o... 61 1e-07 gb|ONK78909.1| uncharacterized protein A4U43_C01F900 [Asparagus ... 61 1e-07 ref|XP_019708766.1| PREDICTED: WD repeat-containing protein 76 i... 61 1e-07 ref|XP_010932229.1| PREDICTED: WD repeat-containing protein 76 i... 61 1e-07 gb|OAY76446.1| WD repeat-containing protein 76 [Ananas comosus] 60 1e-07 gb|ERN10329.1| hypothetical protein AMTR_s00026p00026130 [Ambore... 57 2e-07 ref|XP_020109306.1| WD repeat-containing protein 76 [Ananas como... 60 2e-07 ref|XP_017695920.1| PREDICTED: WD repeat-containing protein 76, ... 60 2e-07 ref|XP_020705223.1| WD repeat-containing protein 76 isoform X2 [... 59 6e-07 ref|XP_020705221.1| WD repeat-containing protein 76 isoform X1 [... 59 6e-07 gb|ERN10331.1| hypothetical protein AMTR_s00026p00028820 [Ambore... 55 8e-07 gb|POE68098.1| dna damage-binding protein cmr1 [Quercus suber] 57 3e-06 ref|XP_020525731.1| WD repeat-containing protein 76 isoform X3 [... 57 3e-06 ref|XP_020525729.1| WD repeat-containing protein 76 isoform X1 [... 57 3e-06 ref|XP_020080954.1| WD repeat-containing protein 76-like [Ananas... 56 5e-06 dbj|GAU11990.1| hypothetical protein TSUD_196140 [Trifolium subt... 56 6e-06 >ref|XP_020580413.1| WD repeat-containing protein 76 [Phalaenopsis equestris] Length = 480 Score = 61.6 bits (148), Expect = 6e-08 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +3 Query: 417 STYRAIWGWDDSYLFIGNMERAIDPISASNKTTT 518 ST+RA+WGWDDS+LF+GNM RA+D IS S+KTTT Sbjct: 408 STFRAVWGWDDSFLFLGNMRRAVDVISISSKTTT 441 >gb|OAY71546.1| DNA damage-binding protein CMR1, partial [Ananas comosus] Length = 243 Score = 60.5 bits (145), Expect = 8e-08 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +3 Query: 417 STYRAIWGWDDSYLFIGNMERAIDPISASNKTTT 518 ST+RAIWGWDDSYL++GNM RA+D IS +++TTT Sbjct: 180 STFRAIWGWDDSYLYLGNMRRAVDVISVADRTTT 213 >ref|XP_020251708.1| WD repeat-containing protein 76 [Asparagus officinalis] Length = 340 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +3 Query: 417 STYRAIWGWDDSYLFIGNMERAIDPISASNKTTT 518 S +RAIWGWDDSY+F+GNM+RAID IS +N TTT Sbjct: 266 SAFRAIWGWDDSYVFVGNMKRAIDVISTANNTTT 299 >gb|ONK78909.1| uncharacterized protein A4U43_C01F900 [Asparagus officinalis] Length = 392 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +3 Query: 417 STYRAIWGWDDSYLFIGNMERAIDPISASNKTTT 518 S +RAIWGWDDSY+F+GNM+RAID IS +N TTT Sbjct: 263 SAFRAIWGWDDSYVFVGNMKRAIDVISTANNTTT 296 >ref|XP_019708766.1| PREDICTED: WD repeat-containing protein 76 isoform X2 [Elaeis guineensis] Length = 431 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +3 Query: 417 STYRAIWGWDDSYLFIGNMERAIDPISASNKTTT 518 S++RAIWGWDDSYLF+GNM RA+D IS S +TTT Sbjct: 359 SSFRAIWGWDDSYLFLGNMRRAVDVISVSERTTT 392 >ref|XP_010932229.1| PREDICTED: WD repeat-containing protein 76 isoform X1 [Elaeis guineensis] Length = 467 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +3 Query: 417 STYRAIWGWDDSYLFIGNMERAIDPISASNKTTT 518 S++RAIWGWDDSYLF+GNM RA+D IS S +TTT Sbjct: 395 SSFRAIWGWDDSYLFLGNMRRAVDVISVSERTTT 428 >gb|OAY76446.1| WD repeat-containing protein 76 [Ananas comosus] Length = 315 Score = 60.5 bits (145), Expect = 1e-07 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +3 Query: 417 STYRAIWGWDDSYLFIGNMERAIDPISASNKTTT 518 ST+RAIWGWDDSYL++GNM RA+D IS +++TTT Sbjct: 243 STFRAIWGWDDSYLYLGNMRRAVDVISVADRTTT 276 >gb|ERN10329.1| hypothetical protein AMTR_s00026p00026130 [Amborella trichopoda] Length = 86 Score = 56.6 bits (135), Expect = 2e-07 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +3 Query: 417 STYRAIWGWDDSYLFIGNMERAIDPISASNKTTT 518 S +RAIWGWDDSYLF+GNM+RA+D I N+TT+ Sbjct: 14 SFFRAIWGWDDSYLFVGNMKRAVDVIYVVNRTTS 47 >ref|XP_020109306.1| WD repeat-containing protein 76 [Ananas comosus] Length = 450 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +3 Query: 417 STYRAIWGWDDSYLFIGNMERAIDPISASNKTTT 518 ST+RAIWGWDDSYL++GNM RA+D IS +++TTT Sbjct: 391 STFRAIWGWDDSYLYLGNMRRAVDVISVADRTTT 424 >ref|XP_017695920.1| PREDICTED: WD repeat-containing protein 76, partial [Phoenix dactylifera] Length = 402 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 417 STYRAIWGWDDSYLFIGNMERAIDPISASNKTTT 518 S++RAIWGWDDSYLF+GNM RA+D IS KTTT Sbjct: 330 SSFRAIWGWDDSYLFLGNMRRAVDVISIKEKTTT 363 >ref|XP_020705223.1| WD repeat-containing protein 76 isoform X2 [Dendrobium catenatum] Length = 496 Score = 58.9 bits (141), Expect = 6e-07 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +3 Query: 417 STYRAIWGWDDSYLFIGNMERAIDPISASNKTTT 518 S++RAIWGWDDS+LF+GNM RA+D IS ++KTTT Sbjct: 424 SSFRAIWGWDDSFLFLGNMRRAVDIISITSKTTT 457 >ref|XP_020705221.1| WD repeat-containing protein 76 isoform X1 [Dendrobium catenatum] gb|PKU67631.1| Protein DAMAGED DNA-BINDING 2 [Dendrobium catenatum] Length = 499 Score = 58.9 bits (141), Expect = 6e-07 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +3 Query: 417 STYRAIWGWDDSYLFIGNMERAIDPISASNKTTT 518 S++RAIWGWDDS+LF+GNM RA+D IS ++KTTT Sbjct: 427 SSFRAIWGWDDSFLFLGNMRRAVDIISITSKTTT 460 >gb|ERN10331.1| hypothetical protein AMTR_s00026p00028820 [Amborella trichopoda] Length = 85 Score = 54.7 bits (130), Expect = 8e-07 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = +3 Query: 417 STYRAIWGWDDSYLFIGNMERAIDPISASNKTTT 518 S++RAIWGWDDSYLF+G+M+R +D IS KT T Sbjct: 13 SSFRAIWGWDDSYLFMGSMKRTVDVISVEKKTIT 46 >gb|POE68098.1| dna damage-binding protein cmr1 [Quercus suber] Length = 399 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +3 Query: 414 SSTYRAIWGWDDSYLFIGNMERAIDPISASNKTT 515 +S++RAIWGWDDSY+FIGNMER +D IS + K T Sbjct: 264 TSSFRAIWGWDDSYIFIGNMERGVDVISPTQKGT 297 >ref|XP_020525731.1| WD repeat-containing protein 76 isoform X3 [Amborella trichopoda] Length = 479 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +3 Query: 417 STYRAIWGWDDSYLFIGNMERAIDPISASNKTTT 518 S +RAIWGWDDSYLF+GNM+RA+D I N+TT+ Sbjct: 432 SFFRAIWGWDDSYLFVGNMKRAVDVIYVVNRTTS 465 >ref|XP_020525729.1| WD repeat-containing protein 76 isoform X1 [Amborella trichopoda] Length = 504 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +3 Query: 417 STYRAIWGWDDSYLFIGNMERAIDPISASNKTTT 518 S +RAIWGWDDSYLF+GNM+RA+D I N+TT+ Sbjct: 432 SFFRAIWGWDDSYLFVGNMKRAVDVIYVVNRTTS 465 >ref|XP_020080954.1| WD repeat-containing protein 76-like [Ananas comosus] Length = 459 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +3 Query: 417 STYRAIWGWDDSYLFIGNMERAIDPISASNKTTT 518 S RAIWGWDDSYL++GNM RA+D IS +++TTT Sbjct: 387 SICRAIWGWDDSYLYLGNMRRAVDVISVADRTTT 420 >dbj|GAU11990.1| hypothetical protein TSUD_196140 [Trifolium subterraneum] Length = 479 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = +3 Query: 417 STYRAIWGWDDSYLFIGNMERAIDPISASNKTT 515 ST+RAIWGWD+SYLFIGNM+R +D +S ++TT Sbjct: 395 STFRAIWGWDNSYLFIGNMKRGVDVVSTVHRTT 427