BLASTX nr result
ID: Ophiopogon22_contig00006779
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00006779 (549 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OMO55200.1| hypothetical protein COLO4_36132 [Corchorus olito... 77 4e-14 ref|XP_023907363.1| rhodanese-like domain-containing protein 9, ... 74 7e-14 dbj|GAY32574.1| hypothetical protein CUMW_003110 [Citrus unshiu] 74 7e-14 ref|XP_009418479.1| PREDICTED: rhodanese-like domain-containing ... 77 1e-13 ref|XP_018686839.1| PREDICTED: rhodanese-like domain-containing ... 77 1e-13 ref|XP_022882655.1| rhodanese-like domain-containing protein 9, ... 76 1e-13 gb|OWM78952.1| hypothetical protein CDL15_Pgr003123 [Punica gran... 76 1e-13 dbj|GAV63932.1| Rhodanese domain-containing protein [Cephalotus ... 76 1e-13 ref|XP_020265272.1| rhodanese-like domain-containing protein 9, ... 76 2e-13 ref|XP_020265271.1| rhodanese-like domain-containing protein 9, ... 76 2e-13 ref|XP_021893953.1| rhodanese-like domain-containing protein 9, ... 75 3e-13 ref|XP_022742232.1| rhodanese-like domain-containing protein 9, ... 75 3e-13 ref|XP_015871209.1| PREDICTED: rhodanese-like domain-containing ... 75 4e-13 ref|XP_015871137.1| PREDICTED: rhodanese-like domain-containing ... 75 4e-13 ref|XP_010036471.1| PREDICTED: rhodanese-like domain-containing ... 74 5e-13 gb|OMO63079.1| hypothetical protein CCACVL1_22494 [Corchorus cap... 76 5e-13 gb|OVA11188.1| Rhodanese-like domain [Macleaya cordata] 75 5e-13 gb|PIN13209.1| Rhodanese-related sulfurtransferase [Handroanthus... 75 6e-13 ref|XP_008782881.1| PREDICTED: rhodanese-like domain-containing ... 74 6e-13 ref|XP_010036470.1| PREDICTED: rhodanese-like domain-containing ... 74 6e-13 >gb|OMO55200.1| hypothetical protein COLO4_36132 [Corchorus olitorius] Length = 204 Score = 77.0 bits (188), Expect = 4e-14 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -1 Query: 549 LVTIQGKISAVLGTVLICAFLFITFFPDQAEKLLQMSPTS 430 LVTIQG+ISAVLGTVL+CAFLFITFFPDQAEKLLQM+PTS Sbjct: 165 LVTIQGQISAVLGTVLVCAFLFITFFPDQAEKLLQMAPTS 204 >ref|XP_023907363.1| rhodanese-like domain-containing protein 9, chloroplastic [Quercus suber] gb|POF17224.1| rhodanese-like domain-containing protein 9, chloroplastic [Quercus suber] Length = 89 Score = 73.6 bits (179), Expect = 7e-14 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -1 Query: 549 LVTIQGKISAVLGTVLICAFLFITFFPDQAEKLLQMSPTS 430 LVT+QGKISAVLGTVL+CA+LFITFFP+QAEKLLQ +PTS Sbjct: 50 LVTVQGKISAVLGTVLVCAYLFITFFPEQAEKLLQFAPTS 89 >dbj|GAY32574.1| hypothetical protein CUMW_003110 [Citrus unshiu] Length = 89 Score = 73.6 bits (179), Expect = 7e-14 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -1 Query: 549 LVTIQGKISAVLGTVLICAFLFITFFPDQAEKLLQMSPTS 430 LVT+QGKISAVLGTVLICAFLFITFFP+QAEKL Q+SP S Sbjct: 50 LVTVQGKISAVLGTVLICAFLFITFFPEQAEKLFQLSPAS 89 >ref|XP_009418479.1| PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic isoform X2 [Musa acuminata subsp. malaccensis] Length = 232 Score = 76.6 bits (187), Expect = 1e-13 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -1 Query: 549 LVTIQGKISAVLGTVLICAFLFITFFPDQAEKLLQMSPTS 430 LVTIQGKISAVLGTVLICAFLFITFFP+QAEKLLQMSP S Sbjct: 193 LVTIQGKISAVLGTVLICAFLFITFFPEQAEKLLQMSPAS 232 >ref|XP_018686839.1| PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic isoform X1 [Musa acuminata subsp. malaccensis] Length = 242 Score = 76.6 bits (187), Expect = 1e-13 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -1 Query: 549 LVTIQGKISAVLGTVLICAFLFITFFPDQAEKLLQMSPTS 430 LVTIQGKISAVLGTVLICAFLFITFFP+QAEKLLQMSP S Sbjct: 203 LVTIQGKISAVLGTVLICAFLFITFFPEQAEKLLQMSPAS 242 >ref|XP_022882655.1| rhodanese-like domain-containing protein 9, chloroplastic [Olea europaea var. sylvestris] Length = 232 Score = 76.3 bits (186), Expect = 1e-13 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = -1 Query: 549 LVTIQGKISAVLGTVLICAFLFITFFPDQAEKLLQMSPTS 430 LVT+QGKISAVLGTVLICAFLFITFFPDQAEK+LQM+P+S Sbjct: 193 LVTVQGKISAVLGTVLICAFLFITFFPDQAEKILQMAPSS 232 >gb|OWM78952.1| hypothetical protein CDL15_Pgr003123 [Punica granatum] gb|PKI42869.1| hypothetical protein CRG98_036667 [Punica granatum] Length = 235 Score = 76.3 bits (186), Expect = 1e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 549 LVTIQGKISAVLGTVLICAFLFITFFPDQAEKLLQMSPTS 430 LVTIQGKISAVLGTVLICAFLFITFFPDQAEKL Q++PTS Sbjct: 196 LVTIQGKISAVLGTVLICAFLFITFFPDQAEKLFQLAPTS 235 >dbj|GAV63932.1| Rhodanese domain-containing protein [Cephalotus follicularis] Length = 235 Score = 76.3 bits (186), Expect = 1e-13 Identities = 34/40 (85%), Positives = 40/40 (100%) Frame = -1 Query: 549 LVTIQGKISAVLGTVLICAFLFITFFPDQAEKLLQMSPTS 430 LVT+QGKISAV+GT+L+CAFLF+TFFPDQAEKLLQM+PTS Sbjct: 196 LVTVQGKISAVVGTILVCAFLFVTFFPDQAEKLLQMAPTS 235 >ref|XP_020265272.1| rhodanese-like domain-containing protein 9, chloroplastic isoform X2 [Asparagus officinalis] Length = 227 Score = 75.9 bits (185), Expect = 2e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 549 LVTIQGKISAVLGTVLICAFLFITFFPDQAEKLLQMSPTS 430 LVT+QGKISAVLGTVLICA+LFITFFPDQAEK+LQMSP S Sbjct: 188 LVTVQGKISAVLGTVLICAYLFITFFPDQAEKILQMSPAS 227 >ref|XP_020265271.1| rhodanese-like domain-containing protein 9, chloroplastic isoform X1 [Asparagus officinalis] gb|ONK70063.1| uncharacterized protein A4U43_C05F29860 [Asparagus officinalis] Length = 231 Score = 75.9 bits (185), Expect = 2e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 549 LVTIQGKISAVLGTVLICAFLFITFFPDQAEKLLQMSPTS 430 LVT+QGKISAVLGTVLICA+LFITFFPDQAEK+LQMSP S Sbjct: 192 LVTVQGKISAVLGTVLICAYLFITFFPDQAEKILQMSPAS 231 >ref|XP_021893953.1| rhodanese-like domain-containing protein 9, chloroplastic [Carica papaya] Length = 229 Score = 75.5 bits (184), Expect = 3e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 549 LVTIQGKISAVLGTVLICAFLFITFFPDQAEKLLQMSPTS 430 LVTIQGKISAVLGTVLICA+LFITFFP+QAEKLLQMSP S Sbjct: 190 LVTIQGKISAVLGTVLICAYLFITFFPEQAEKLLQMSPAS 229 >ref|XP_022742232.1| rhodanese-like domain-containing protein 9, chloroplastic [Durio zibethinus] Length = 236 Score = 75.5 bits (184), Expect = 3e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 549 LVTIQGKISAVLGTVLICAFLFITFFPDQAEKLLQMSPTS 430 LVTIQGKISAVLGTVLICA+LFITFFP+QAEKLLQMSP S Sbjct: 197 LVTIQGKISAVLGTVLICAYLFITFFPEQAEKLLQMSPAS 236 >ref|XP_015871209.1| PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic isoform X2 [Ziziphus jujuba] ref|XP_015868127.1| PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic isoform X2 [Ziziphus jujuba] Length = 236 Score = 75.1 bits (183), Expect = 4e-13 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -1 Query: 549 LVTIQGKISAVLGTVLICAFLFITFFPDQAEKLLQMSPT 433 LVTIQGKISAVLGTVLICA+LFITFFPDQAEKLLQ++PT Sbjct: 197 LVTIQGKISAVLGTVLICAYLFITFFPDQAEKLLQLAPT 235 >ref|XP_015871137.1| PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic isoform X1 [Ziziphus jujuba] ref|XP_015868126.1| PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic isoform X1 [Ziziphus jujuba] Length = 240 Score = 75.1 bits (183), Expect = 4e-13 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -1 Query: 549 LVTIQGKISAVLGTVLICAFLFITFFPDQAEKLLQMSPT 433 LVTIQGKISAVLGTVLICA+LFITFFPDQAEKLLQ++PT Sbjct: 201 LVTIQGKISAVLGTVLICAYLFITFFPDQAEKLLQLAPT 239 >ref|XP_010036471.1| PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic isoform X3 [Eucalyptus grandis] gb|KCW48082.1| hypothetical protein EUGRSUZ_K01824 [Eucalyptus grandis] Length = 204 Score = 74.3 bits (181), Expect = 5e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 549 LVTIQGKISAVLGTVLICAFLFITFFPDQAEKLLQMSPTS 430 LVTIQGKISAVLGTVL+CAFLFITFFPDQAEKLLQ+ P S Sbjct: 165 LVTIQGKISAVLGTVLVCAFLFITFFPDQAEKLLQLVPAS 204 >gb|OMO63079.1| hypothetical protein CCACVL1_22494 [Corchorus capsularis] Length = 366 Score = 76.3 bits (186), Expect = 5e-13 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = -1 Query: 549 LVTIQGKISAVLGTVLICAFLFITFFPDQAEKLLQMSPTS 430 LVTIQG+ISAVLGTVL+CAFLFITFFPDQAEK+LQM+PTS Sbjct: 327 LVTIQGQISAVLGTVLVCAFLFITFFPDQAEKILQMAPTS 366 >gb|OVA11188.1| Rhodanese-like domain [Macleaya cordata] Length = 235 Score = 74.7 bits (182), Expect = 5e-13 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -1 Query: 549 LVTIQGKISAVLGTVLICAFLFITFFPDQAEKLLQMSPTS 430 LVT+QGKISAVLGT+LICA+LFITFFPDQAEKLLQM+P S Sbjct: 196 LVTVQGKISAVLGTILICAYLFITFFPDQAEKLLQMTPLS 235 >gb|PIN13209.1| Rhodanese-related sulfurtransferase [Handroanthus impetiginosus] Length = 239 Score = 74.7 bits (182), Expect = 6e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 549 LVTIQGKISAVLGTVLICAFLFITFFPDQAEKLLQMSPTS 430 LVTIQGKISAVLGTVLICA+LFITFFPDQAEKLLQ++P S Sbjct: 200 LVTIQGKISAVLGTVLICAYLFITFFPDQAEKLLQLAPAS 239 >ref|XP_008782881.1| PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic [Phoenix dactylifera] ref|XP_008782882.1| PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic [Phoenix dactylifera] Length = 219 Score = 74.3 bits (181), Expect = 6e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 549 LVTIQGKISAVLGTVLICAFLFITFFPDQAEKLLQMSPTS 430 LVT+QGKISAVLGTVLICAFLFITFFP+QAEKLLQM P S Sbjct: 180 LVTVQGKISAVLGTVLICAFLFITFFPEQAEKLLQMGPPS 219 >ref|XP_010036470.1| PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic isoform X2 [Eucalyptus grandis] Length = 222 Score = 74.3 bits (181), Expect = 6e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 549 LVTIQGKISAVLGTVLICAFLFITFFPDQAEKLLQMSPTS 430 LVTIQGKISAVLGTVL+CAFLFITFFPDQAEKLLQ+ P S Sbjct: 183 LVTIQGKISAVLGTVLVCAFLFITFFPDQAEKLLQLVPAS 222